FGL2 Protein, Mouse (Biotinylated, HEK293, His-Avi, Flag)

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (Biotinylated, HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

FGL2 (Fibrinogen-Like Protein 2) is a crucial enzyme involved in the coagulation pathway, exerting its function by converting prothrombin into thrombin. This conversion is a pivotal step in the blood clotting process, playing a fundamental role in maintaining hemostasis. Structurally, FGL2 forms a homotetramer, indicating the assembly of four identical subunits. The integrity of this tetrameric structure is maintained through disulfide linkages between the subunits. The homotetrameric arrangement suggests a cooperative mechanism, potentially enhancing the efficiency of FGL2 in its prothrombin-to-thrombin conversion activity. Ongoing research may reveal additional insights into the specific regulatory mechanisms and physiological implications of FGL2 in the coagulation cascade.

Mouse

HEK293

C-Avi;N-His;N-Flag

P12804 (P197-P432)

14190  [NCBI]

Partial

Biotin

PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.