FGL2 Protein, Mouse (Biotinylated, HEK293, His-Avi, Flag)
FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (Biotinylated, HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (Biotinylated, HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.
Background
FGL2 (Fibrinogen-Like Protein 2) is a crucial enzyme involved in the coagulation pathway, exerting its function by converting prothrombin into thrombin. This conversion is a pivotal step in the blood clotting process, playing a fundamental role in maintaining hemostasis. Structurally, FGL2 forms a homotetramer, indicating the assembly of four identical subunits. The integrity of this tetrameric structure is maintained through disulfide linkages between the subunits. The homotetrameric arrangement suggests a cooperative mechanism, potentially enhancing the efficiency of FGL2 in its prothrombin-to-thrombin conversion activity. Ongoing research may reveal additional insights into the specific regulatory mechanisms and physiological implications of FGL2 in the coagulation cascade.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;N-His;N-Flag
-
Accession
P12804 (P197-P432)
-
Protein Length
Full Length of Fibrinogen C-terminal Domain
-
Conjugation
Biotin
-
Synonyms
FGL2; Fibrinogen-Like Protein 2; Fibrinogen Like 2; T49; Fibroleukin; Fibrinogen-Like 2; PT49
-
AA Sequence
PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
-
Predicted Molecular Mass
31.5 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
