FGL2 Protein, Mouse (HEK293, His-Avi, Flag)

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

FGL2 (Fibrinogen-Like Protein 2) is a crucial enzyme involved in the coagulation pathway, exerting its function by converting prothrombin into thrombin. This conversion is a pivotal step in the blood clotting process, playing a fundamental role in maintaining hemostasis. Structurally, FGL2 forms a homotetramer, indicating the assembly of four identical subunits. The integrity of this tetrameric structure is maintained through disulfide linkages between the subunits. The homotetrameric arrangement suggests a cooperative mechanism, potentially enhancing the efficiency of FGL2 in its prothrombin-to-thrombin conversion activity. Ongoing research may reveal additional insights into the specific regulatory mechanisms and physiological implications of FGL2 in the coagulation cascade.

Immobilized Mouse FGL2, His Tag at 5μg/mL (100μL/well) can bind anti-FGL2 Antibody, The ED₅₀ for this effect is 5.068 ng/mL.

• 
  Immobilized Mouse FGL2, His Tag at 5 μg/mL (100 μL/well) can bind anti-FGL2 Antibody, The ED₅₀ for this effect is 5.068 ng/mL.

Mouse

HEK293

C-Avi;N-His;N-Flag

P12804 (P197-P432)

14190  [NCBI]

Partial

PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.