Copy Link Print Information

FGL2 Protein, Mouse (HEK293, His-Avi, Flag)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGL2 Protein, Mouse (HEK293, His-Avi, Flag)
  • Experimental Validation Results for FGL2 Protein, Mouse (HEK293, His-Avi, Flag)
  • FGL2 Protein, Mouse (HEK293, His-Avi, Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.

Background

FGL2 (Fibrinogen-Like Protein 2) is a crucial enzyme involved in the coagulation pathway, exerting its function by converting prothrombin into thrombin. This conversion is a pivotal step in the blood clotting process, playing a fundamental role in maintaining hemostasis. Structurally, FGL2 forms a homotetramer, indicating the assembly of four identical subunits. The integrity of this tetrameric structure is maintained through disulfide linkages between the subunits. The homotetrameric arrangement suggests a cooperative mechanism, potentially enhancing the efficiency of FGL2 in its prothrombin-to-thrombin conversion activity. Ongoing research may reveal additional insights into the specific regulatory mechanisms and physiological implications of FGL2 in the coagulation cascade.

Verified Bioactivity

Immobilized Mouse FGL2, His Tag at 5μg/mL (100μL/well) can bind anti-FGL2 Antibody, The ED50 for this effect is 5.068 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Mouse FGL2, His Tag at 5 μg/mL (100 μL/well) can bind anti-FGL2 Antibody, The ED50 for this effect is 5.068 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;N-His;N-Flag
  • Accession

    P12804 (P197-P432)

  • Gene ID
    14190  [NCBI]
  • Protein Length

    Full Length of Fibrinogen C-terminal Domain

  • Synonyms

    FGL2; Fibrinogen-Like Protein 2; Fibrinogen Like 2; T49; Fibroleukin; Fibrinogen-Like 2; PT49

  • AA Sequence

    PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Mouse FGL2, His Tag at 5 μg/mL (100 μL/well) can bind anti-FGL2 Antibody, The ED50 for this effect is 5.068 ng/mL.

  • FGL2 Protein, Mouse (HEK293, His-Avi, Flag) Product Image
    1/16
  • Experimental Validation Results for FGL2 Protein, Mouse (HEK293, His-Avi, Flag)
  • Experimental Validation Results for FGL2 Protein, Mouse (HEK293, His-Avi, Flag)
  • FGL2 Protein, Mouse (HEK293, His-Avi, Flag) Product Image