FKBP2 Protein, Human (HEK293, His)
FKBP2 protein plays a central role in the complex process of protein folding and is an important peptidyl prolyl cis-trans isomerase (PPIase). Its unique ability to catalyze the cis-trans isomerization of proline imide peptide bonds accelerates dynamic conformational changes that are critical for efficient protein folding. FKBP2 Protein, Human (HEK293, His) is the recombinant human-derived FKBP2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FKBP2 protein plays a central role in the complex process of protein folding and is an important peptidyl prolyl cis-trans isomerase (PPIase). Its unique ability to catalyze the cis-trans isomerization of proline imide peptide bonds accelerates dynamic conformational changes that are critical for efficient protein folding. FKBP2 Protein, Human (HEK293, His) is the recombinant human-derived FKBP2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
FKBP2 Protein takes center stage as a pivotal participant in the intricate process of protein folding, showcasing its essential role as a peptidyl-prolyl cis-trans isomerase (PPIase). With a distinctive capacity to catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, FKBP2 actively accelerates the dynamic conformational changes crucial for the efficient folding of proteins. This enzymatic activity underscores FKBP2's significance in facilitating the correct maturation and structural integrity of nascent or misfolded polypeptides, thereby contributing to the overall maintenance of cellular protein homeostasis. As a member of the PPIase family, FKBP2 plays a fundamental role in the intricate ballet of protein folding, warranting further exploration to unravel the specific molecular mechanisms and cellular contexts through which FKBP2 actively engages in this crucial cellular process.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P26885 (A22-L142)
-
Molecular Construction
-
N-term
-
FKBP2 (A22-L142)
Accession # P26885 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FKBP2; Proline Isomerase; FKBP Prolyl Isomerase 2; PPIase FKBP2; FKBP-13; 13 KDa FKBP; FKBP13; Rotamase; PPIase; Epididymis Secretory Sperm Binding Protein; Peptidyl-Prolyl Cis-Trans Isomerase FKBP2; Peptidyl-Prolyl Cis-Trans Isomerase; FK506 Binding Prot
-
AA Sequence
ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
-
Predicted Molecular Mass
14.3 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
