FOLR2 Protein, Human (Biotinylated, HEK293, His-Avi)
FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR2 Protein, Human (Biotinylated, HEK293, His-Avi) is 212 a.a., with molecular weight of 30-40 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of FOLR2 Protein, Human (Biotinylated, HEK293, His-Avi) is 212 a.a., with molecular weight of 30-40 kDa.
Background
The FOLR2 protein binds to folate and reduced folic acid derivatives, facilitating the transport of 5-methyltetrahydrofolate and folate analogs into the intracellular space. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. However, upon receptor endocytosis, exposure to a slightly acidic pH triggers a conformational change in FOLR2, resulting in a significant reduction in its affinity for folates and subsequent release from the receptor.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P14207 (T17-H228)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
FOLR2; FOLR2 Protein; Folate Receptor Beta; BETA-HFR; Folate Receptor, Fetal/Placental; FBP/PL-1; Placental Folate-Binding Protein; FR-BETA; Folate Receptor 2 (Fetal); FR-Beta; FBP; FRbeta; Folate-Binding Protein, Fetal/Placental; FR-P3; Folate Receptor A
-
AA Sequence
TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH
-
Predicted Molecular Mass
28.2 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
