1. Recombinant Proteins
  2. Receptor Proteins
  3. FOLR3 Protein, Human (HEK293, His)

FOLR3 protein is crucial in folate metabolism, binding to folate and aiding 5-methyltetrahydrofolate delivery into cells. Notably, the Isoform Short of FOLR3 lacks folate-binding capabilities, indicating diverse functional roles among FOLR3 isoforms. This highlights nuanced regulation in cellular folate transport processes. FOLR3 Protein, Human (HEK293, His) is the recombinant human-derived FOLR3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FOLR3 protein is crucial in folate metabolism, binding to folate and aiding 5-methyltetrahydrofolate delivery into cells. Notably, the Isoform Short of FOLR3 lacks folate-binding capabilities, indicating diverse functional roles among FOLR3 isoforms. This highlights nuanced regulation in cellular folate transport processes. FOLR3 Protein, Human (HEK293, His) is the recombinant human-derived FOLR3 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FOLR3 protein plays a pivotal role in folate metabolism, binding to folate and reduced folic acid derivatives while facilitating the delivery of 5-methyltetrahydrofolate to the interior of cells. It is noteworthy that the Isoform Short of FOLR3 does not exhibit folate-binding capabilities. This differential binding behavior suggests distinct functional roles for the various isoforms of FOLR3, emphasizing the nuanced regulation of folate transport within cellular processes.

Biological Activity

Human FOLR3 protein captured on CM5 chip can bind Folic acid with an affinity constant of 0.122 nM as detected by SPR assay(Biacore T200).

Species

Human

Source

HEK293

Tag

C-His

Accession

P41439 (Q23-S245)

Gene ID
Molecular Construction
N-term
FOLR3 (Q23-S245)
Accession # P41439
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
folate receptor 3 (gamma); Folate receptor 3; folate receptor gamma; FOLR3; FR-G; FR-gamma; gamma-Hfr;
AA Sequence

QPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

Molecular Weight

33-45 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FOLR3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FOLR3 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOLR3 Protein, Human (HEK293, His)
Cat. No.:
HY-P78766
Quantity:
MCE Japan Authorized Agent: