FOLR3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
FOLR3 protein is crucial in folate metabolism, binding to folate and aiding 5-methyltetrahydrofolate delivery into cells. Notably, the Isoform Short of FOLR3 lacks folate-binding capabilities, indicating diverse functional roles among FOLR3 isoforms. This highlights nuanced regulation in cellular folate transport processes. FOLR3 Protein, Human (HEK293, His) is the recombinant human-derived FOLR3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR3 protein is crucial in folate metabolism, binding to folate and aiding 5-methyltetrahydrofolate delivery into cells. Notably, the Isoform Short of FOLR3 lacks folate-binding capabilities, indicating diverse functional roles among FOLR3 isoforms. This highlights nuanced regulation in cellular folate transport processes. FOLR3 Protein, Human (HEK293, His) is the recombinant human-derived FOLR3 protein, expressed by HEK293 , with C-His labeled tag.
Background
The FOLR3 protein plays a pivotal role in folate metabolism, binding to folate and reduced folic acid derivatives while facilitating the delivery of 5-methyltetrahydrofolate to the interior of cells. It is noteworthy that the Isoform Short of FOLR3 does not exhibit folate-binding capabilities. This differential binding behavior suggests distinct functional roles for the various isoforms of FOLR3, emphasizing the nuanced regulation of folate transport within cellular processes.
Verified Bioactivity
Human FOLR3 protein captured on CM5 chip can bind Folic acid with an affinity constant of 0.122 nM as detected by SPR assay(Biacore T200).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P41439 (Q23-S245)
-
Molecular Construction
-
N-term
-
FOLR3 (Q23-S245)
Accession # P41439 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FOLR3; FR-Gamma; Folate Receptor Gamma; Gamma-HFR; FR-G; FRgamma; Folate Receptor 3 (Gamma); FRγ; Folate Receptor 3; FRG
-
AA Sequence
QPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
-
Predicted Molecular Mass
27 kDa
-
Molecular Weight
Approximately 33-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
