FXR Protein, Human (sf9, GST)
FXR Protein, Human (sf9, GST) is the recombinant human-derived FXR, expressed by Sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FXR Protein, Human (sf9, GST) is the recombinant human-derived FXR, expressed by Sf9 insect cells , with N-GST labeled tag.
Background
FXR is a ligand-activated transcription factor that serves as a receptor for bile acids (BAs), including chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA), and allocholic acid (ACA). It plays a crucial role in BA homeostasis by regulating genes involved in BA synthesis, conjugation, and enterohepatic circulation. Additionally, FXR modulates lipid and glucose metabolism and participates in innate immune responses. The FXR-RXR heterodimer primarily binds to farnesoid X receptor response elements (FXREs) containing two inverted repeats of the consensus sequence 5'-AGGTCA-3' (IR-1), with lower affinity for tandem repeat DR1 sites. In the liver, FXR activates transcription of the corepressor NR0B2, indirectly inhibiting CYP7A1 and CYP8B1 (involved in BA synthesis) through epigenetic repression mediated by histone demethylase KDM1A. It also activates genes such as SLC10A1/NTCP (BA uptake), SLC27A5/BACS, BAAT (BA conjugation), ABCB11/BSEP (bile salt export), ABCC2/MRP2, and ABCB4 (phosphatidylcholine secretion). In the intestine, FXR induces FGF19 expression, which suppresses hepatic CYP7A1. Furthermore, FXR regulates lipid metabolism by modulating SREBF1, PLTP, SCARB1, APOE, and other genes, and influences glucose homeostasis via NR0B2/SHP-mediated repression. FXR also contributes to intestinal innate immunity by suppressing inflammatory cytokines and maintaining epithelial barrier integrity. By similarity: FXR transcriptional activity is modulated by monomeric nuclear receptors (e.g., NR5A2/LRH-1) binding to coregulatory NRE half-sites; it coordinates FGF19 action through hepatic KLB/beta-klotho induction; regulates glycogen synthesis; inhibits bacterial overgrowth in the gut; and exhibits anti-inflammatory effects in liver inflammation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q96RI1-2 (L193-Q472)
-
Gene ID9971
-
Molecular Construction
-
N-term
-
GST
-
FXR (L193-Q472)
Accession # Q96RI1-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NR1H4; Farnesol Receptor HRR-1; Nuclear Receptor Subfamily 1 Group H Member 4; HRR-1; Bile Acid Receptor; RXR-Interacting Protein 14; RIP14; BAR; HRR1; Nuclear Receptor Subfamily 1, Group H, Member 4; FXR; Farnesoid X Nuclear Receptor; Retinoid X Receptor
-
AA Sequence
LAECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
-
Predicted Molecular Mass
59 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)