G6B Protein, Human (HEK293, Fc)
The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, Fc) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, Fc) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-hFc labeled tag.
Background
G6B, an inhibitory receptor, plays a crucial role in regulating hematopoietic lineage differentiation, megakaryocyte function, and platelet production. This regulatory function extends to inhibiting platelet aggregation and activation induced by various agonists like ADP and collagen-related peptide. The inhibition is mediated through the receptor's impact on CLEC1B and GP6:FcRgamma signaling, involving two immunoreceptor tyrosine-based inhibitor motifs (ITIMs). Notably, G6B operates in a calcium-independent manner. Isoform B, containing both a transmembrane region and the mentioned ITIMs, serves as the inhibitory counterpart, while isoform A is considered the activating counterpart of isoform B. This dual-isoform system reflects the nuanced regulatory mechanisms underlying hematopoiesis and platelet function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O95866-1/NP_612116.1 (N18-Q142)
-
Molecular Construction
-
N-term
-
G6B (N18-Q142)
Accession # O95866-1/NP_612116.16 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MPIG6B; CDNA FLJ35073 Fis, Clone PLACE6000630; Prev. C6orf25; Immunoglobulin Receptor; G6b-B; C6orf25 Protein; NG31; THAMY; G6b; G6B-B; Protein G6b; G6B; Chromosome 6 Open Reading Frame 25, Isoform CRA_h; Megakaryocyte And Platelet Inhibitory Receptor G6b
-
AA Sequence
NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ
-
Predicted Molecular Mass
40.2 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
