Galectin-7/LGALS7 Protein, Human (His)
Based on 1 Customer Validation
Galectin-7/LGALS7 Protein, Human (His) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-7/LGALS7 Protein, Human (His) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli, with N-His tag.
Background
Galectin-7, also known as LGALS7, is a protein potentially involved in critical cell-cell and/or cell-matrix interactions essential for normal growth control. Functioning as a pro-apoptotic protein, Galectin-7 operates intracellularly upstream of JNK activation and cytochrome c release, suggesting its role in apoptotic pathways. It exists as a monomer, and its involvement in cellular interactions and apoptotic processes underscores its significance in regulating cell growth and survival. Understanding the functions of Galectin-7 provides valuable insights into the intricate molecular mechanisms governing normal cellular processes and apoptotic signaling.
Verified Bioactivity
Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is typically 0.2-2 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
NP_002298.1 (S2-F136)
-
Gene ID3963
-
Molecular Construction
-
N-term
-
His
-
LGALS7 (S2-F136)
Accession # NP_002298.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS7; Galectin-7; Galectin 7; TP53I1; LGALS7A; P53-Induced Gene 1 Protein; GAL7; HKL-14; PIG1; Gal-7; Lectin, Galactoside-Binding, Soluble, 7; PI7
-
AA Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
