Galectin-8/LGALS8 Protein, Human
Based on 1 Customer Validation
Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with tag free.
B3GNT4, a key enzyme in glycosylation processes, functions as a beta-1,3-N-acetylglucosaminyltransferase responsible for synthesizing poly-N-acetyllactosamine. This enzyme plays a crucial role in the modification of glycoproteins and glycolipids by catalyzing the transfer of N-acetylglucosamine residues onto acceptor molecules. Notably, B3GNT4 exhibits specific activity for type 2 oligosaccharides, contributing to the diversification and complexity of glycan structures. The synthesis of poly-N-acetyllactosamine by B3GNT4 underscores its significance in modulating cellular interactions, as alterations in glycan structures can impact various biological processes, including cell adhesion, signaling, and recognition events.
Measured by its ability to agglutinate human red blood cells.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O00214-1 (M1-W317)
-
Molecular Construction
-
N-term
-
LGALS8 (M1-W317)
Accession # O00214-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LGALS8; Galectin-8; Galectin 8; Po66-CBP; PCTA-1; Gal-8; Lectin, Galactoside-Binding, Soluble, 8; Po66 Carbohydrate Binding Protein; Prostate Carcinoma Tumor Antigen 1; Alternative Protein LGALS8; Po66 Carbohydrate-Binding Protein; Galectin; Galectin-8g;
-
AA Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)