1. Protéines recombinantes
  2. Cytokines and Growth Factors Receptor Proteins
  3. TGF-beta Superfamily Neurotrophic Factors Cytokine Receptors
  4. GDNF family
  5. GFRAL
  6. GFRAL Protein, Cynomolgus (HEK293, His-Avi)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

GFRAL Protein, a brainstem-restricted receptor for GDF15, plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding to its ligand, GDF15, GFRAL interacts with RET and activates cellular signaling through the MAPK- and AKT-signaling pathways. The receptor, through its extracellular domain, forms complexes with both GDF15 and RET, mediating cellular signaling specifically when RET is engaged after GDF15 binding. This intricate interaction highlights the sequential steps involving GFRAL, GDF15, and RET in the modulation of physiological responses to metabolic challenges.

Species

Cynomolgus

Source

HEK293

Tag

N-Avi;N-8*His

Accession

XP_015304775 (Q20-E351)

Gene ID
Molecular Construction
N-term
8*His-Avi
GFRAL (Q20-E351)
Accession # XP_015304775
C-term
Protein Length

Partial

Synonyms
GFR alpha-like; GFRAL; GRAL; C6orf144
AA Sequence

QTNNCTYLREQCLHDANGCKHAWRIMEDACNDSDPGDPCKMKNSSYCNLSIQYLVESNFRFKECLCTDDFYCTVNKLLGKECVNKSDNMREDKFKWNLTTHSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDVKHCQAAIRFFYQNIPFNIAQMLAFCDCSQSDIPCQQSKEALHSKPCALNMVPPPTCLNVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISALSKQDLTCSGSDDCKAAYIDILGTVLQVQCNCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKSMALYTRKHTNKITLTGFQSPFNGE

Predicted Molecular Mass
40.7 kDa
Masse moléculaire

Approximately 50-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Pureté

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

GFRAL Protein, Cynomolgus (HEK293, His-Avi)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
GFRAL Protein, Cynomolgus (HEK293, His-Avi)
Cat. No.:
HY-P77683
Quantité:
MCE Japan Authorized Agent: