GFRAL Protein, Cynomolgus (HEK293, His-Avi)
The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived GFRAL protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
Background
GFRAL Protein, a brainstem-restricted receptor for GDF15, plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding to its ligand, GDF15, GFRAL interacts with RET and activates cellular signaling through the MAPK- and AKT-signaling pathways. The receptor, through its extracellular domain, forms complexes with both GDF15 and RET, mediating cellular signaling specifically when RET is engaged after GDF15 binding. This intricate interaction highlights the sequential steps involving GFRAL, GDF15, and RET in the modulation of physiological responses to metabolic challenges.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-Avi;N-8*His
-
Accession
XP_015304775 (Q20-E351)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
GFRAL (Q20-E351)
Accession # XP_015304775 -
C-term
-
-
Protein Length
Partial
-
Synonyms
GFRAL; GRAL; Prev. C6orf144; Chromosome 6 Open Reading Frame 144; BA360D14.1; IVFI9356; UNQ9356; GDNF Family Receptor Alpha Like; GDNF Family Receptor Alpha-Like
-
AA Sequence
QTNNCTYLREQCLHDANGCKHAWRIMEDACNDSDPGDPCKMKNSSYCNLSIQYLVESNFRFKECLCTDDFYCTVNKLLGKECVNKSDNMREDKFKWNLTTHSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDVKHCQAAIRFFYQNIPFNIAQMLAFCDCSQSDIPCQQSKEALHSKPCALNMVPPPTCLNVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISALSKQDLTCSGSDDCKAAYIDILGTVLQVQCNCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKSMALYTRKHTNKITLTGFQSPFNGE
-
Predicted Molecular Mass
40.7 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20mM PB, 0.4M NaCl, pH 6.0.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
