GFRAL Protein, Rat (HEK293, His)
GFRAL Protein, Rat (HEK293, His) is the recombinant rat-derived GFRAL, expressed by HEK293 , with N-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GFRAL Protein, Rat (HEK293, His) is the recombinant rat-derived GFRAL, expressed by HEK293 , with N-His labeled tag.
Background
GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-8*His
-
Accession
D3ZB94 (Q20-G350)
-
Gene ID501023
-
Protein Length
Extracellular Domain
-
Synonyms
GFRAL; GRAL; Prev. C6orf144; Chromosome 6 Open Reading Frame 144; BA360D14.1; IVFI9356; UNQ9356; GDNF Family Receptor Alpha Like; GDNF Family Receptor Alpha-Like
-
AA Sequence
QTNDCAYFMRQCLTDTDGCKQSWRSMEDACLVSGDSCKINNPLPCNLSIQSLVEKHFQFKGCLCTDDLHCTVNKIFGKKCTNKTDSMKKDNKYKRNLTTPLYHDTGFKQMQSCLEVTEACVGDVVCNAQLALYLKACTANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNVVPPPTCLSVIHTCRNDELCRTYYRTFQTECWPHVAGKCREDETCISMLGKQDLTCSGSDSCRAAYLGTFGTVLQVPCACRSITQGEEPLCMAFQHMLHSKSCFNYPTPNVKDISSYERKHSKEITLTGFNSPFSG
-
Predicted Molecular Mass
38.2 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
