Glia maturation factor beta/GMFB Protein, Human (His)
Glial maturation factor beta (GMFB) protein serves as a key regulator that promotes brain cell differentiation, stimulates nerve regeneration and inhibits tumor cell proliferation. Phosphorylation, particularly that induced by phorbol esters, enhances its activity, suggesting a finely regulated mechanism in response to external signals. Glia maturation factor beta/GMFB Protein, Human (His) is the recombinant human-derived Glia maturation factor beta/GMFB protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Glial maturation factor beta (GMFB) protein serves as a key regulator that promotes brain cell differentiation, stimulates nerve regeneration and inhibits tumor cell proliferation. Phosphorylation, particularly that induced by phorbol esters, enhances its activity, suggesting a finely regulated mechanism in response to external signals. Glia maturation factor beta/GMFB Protein, Human (His) is the recombinant human-derived Glia maturation factor beta/GMFB protein, expressed by E. coli , with C-6*His labeled tag.
Background
Glia maturation factor beta (GMFB) protein emerges as a key regulator in diverse cellular processes, promoting the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This multifunctional protein undergoes phosphorylation, a modification that enhances its activity and is notably stimulated by phorbol ester. The phosphorylated state of GMFB suggests a regulatory mechanism that fine-tunes its functions in response to external signals, potentially playing a crucial role in cellular signaling cascades. The dual capacity of GMFB to influence both neural development and tumor cell proliferation highlights its versatile and intricate involvement in fundamental biological processes, suggesting its potential as a significant player in the modulation of cellular fate and function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P60983 (M1-H142)
-
Molecular Construction
-
N-term
-
GMFB (M1-H142)
Accession # P60983 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GMFB; GMF; Glia Maturation Factor Beta; GMF-Beta
-
AA Sequence
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
