GLP1R Protein, Human (Biotinylated, HEK293, His-Avi)
The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GLP1R protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GLP1R protein, expressed by HEK293, with N-Avi labeled tag.
Background
The GLP1R Protein functions as a G-protein coupled receptor for glucagon-like peptide 1 (GLP-1), participating in a signaling cascade upon ligand binding that activates adenylyl cyclase and increases intracellular cAMP levels. This molecular interaction plays a crucial role in regulating insulin secretion in response to GLP-1. The receptor's activation contributes to the modulation of cellular responses and metabolic processes associated with GLP-1 signaling. Notably, the allosteric modulators NNC0640, PF-06372222, and MK-0893 demonstrate inhibitory effects on the increase of intracellular cAMP levels in response to GLP-1, offering potential avenues for pharmacological intervention in this signaling pathway.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P43220 (A21-E139)
-
Gene ID2740
-
Molecular Construction
-
N-term
-
GLP1R (A21-E139)
Accession # P43220 -
Avi-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
GLP1R; GLP-1-R; Glucagon Like Peptide 1 Receptor; Seven Transmembrane Helix Receptor; Glucagon-Like Peptide 1 Receptor; GLP1 Receptor; GLP-1R; GLP-1; GLP-1 Receptor
-
AA Sequence
AGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEE
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 30-34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
