GMFG Protein, Human (His)

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

The GMFG protein, belonging to the actin-binding proteins ADF family within the GMF subfamily, is primarily expressed in specific tissues, with a predominant presence noted in the lung, heart, and placenta. As a member of the actin-depolymerizing factor (ADF) family, GMFG likely participates in regulating actin dynamics, a critical process essential for cellular structure, motility, and various intracellular activities. The distinct expression pattern in vital organs suggests potential roles for GMFG in processes such as cell migration, tissue development, or physiological functions specific to the lung, heart, and placenta. Further investigations into GMFG's precise molecular functions and interactions within these tissues could provide valuable insights into its contributions to cellular dynamics and organ-specific processes.

Human

E. coli

N-6*His

O60234 (S2-R142)

9535  [NCBI]

Full Length of Mature Protein

SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.