GMP KGF-2/FGF-10 Protein, Human (171a.a)
KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns. KGF-2/FGF-10 Protein, Human (171a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns[2][3]. KGF-2/FGF-10 Protein, Human (171a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.
Background
KGF-2/FGF-10 (keratinocyte growth factor-2) belongs to the fibroblast growth factor family (FGF family) and is a 20 kD heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 mainly acts on epithelial cells, and its receptors are FGFR2-IIIb and FGFR1-IIIb (IIIb subtype of fibroblast growth factor receptor 2/1) expressed by epithelial cells. Its function is mainly mediated by the FGF-2 IIIb receptor, which is a transmembrane receptor expressed only by epithelial cells[1]. KGF-2 promotes the growth, proliferation and differentiation of epithelial cells and has a good effect in treating epithelial damage. KGF-2 can enhance corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury. KGF-2/FGF-10 regulates epithelial cell proliferation, migration and differentiation by binding to FGFR2-IIIb/FGFR1-IIIb receptors, and participates in tissue repair and inflammation regulation. KGF-2/FGF-10 is induced by inflammatory factors (such as TNF-α and IL-1β) upstream, and promotes cell adhesion downstream through integrins (such as VLA-4)[2][3]. KGF-2/FGF-10 participates in AMPK, PI3K-mTOR, MAPK/ERK and p38 pathways. In the AMPK pathway, KGF-2/FGF-10 activates AMPK in lung injury, inhibits NLRP3 inflammasome and pyroptosis (GSDMD/IL-1β)[2]; in the PI3K-mTOR pathway, KGF-2/FGF-10 promotes alveolar type II cell autophagy (such as increased LC3II and decreased p62)[2]; in the MAPK/ERK and p38 pathways, KGF-2/FGF-10 activates ERK1/2 and p38 in corneal repair, promotes fibroblast migration, and inhibits TGF-β1-induced α-SMA expression and myofibroblast differentiation[3].
KGF-2/FGF-10 can be used in the research of lung diseases, corneal repair, and the prevention and treatment of tissue fibrosis. In the ventilator-induced lung injury (VILI) model, KGF-2/FGF-10 alleviates pulmonary edema by protecting the alveolar-capillary barrier, reducing the release of inflammatory factors (TNF-α, MIP-2), and increasing the expression of surfactant proteins (SP-A/B/C)[2]. KGF-2/FGF-10 accelerates epithelial healing and inhibited scar formation (reduced α-SMA and myofibroblasts) in the corneal alkali burn model, with a better effect than bFGF[3]. KGF-2/FGF-10 also inhibits the differentiation of myofibroblasts and reduces the expression of fibrosis-related proteins[3].
Technical Parameters
-
Species Human
-
Source E. coli
-
Accession
O15520 (Q38-S208)
-
Gene ID2255
-
Molecular Construction
-
N-term
-
FGF-10 (Q38-S208)
Accession # O15520 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF10; Produced By Fibroblasts Of Urinary Bladder Lamina Propria; Fibroblast Growth Factor 10; Fibroblast Growth Factor; Keratinocyte Growth Factor 2; LADD3; FGF-10; FGF
-
AA Sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
-
Predicted Molecular Mass
19.5 kDa
-
Molecular Weight
Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
