GYPA/CD235a Protein, Cynomolgus (HEK293, His)

The GYPA/CD235a protein is an important component of the ankyrin-1 complex, which is critical for the stability and shape of the red blood cell membrane. GYPA/CD235a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GYPA/CD235a protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GYPA/CD235a protein is an important component of the ankyrin-1 complex, which is critical for the stability and shape of the red blood cell membrane. GYPA/CD235a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GYPA/CD235a protein, expressed by HEK293 , with C-His labeled tag.

Background

GYPA, also known as Glycophorin A, serves as a pivotal component within the ankyrin-1 complex, a multiprotein assembly crucial for maintaining the stability and shape of the erythrocyte membrane. As the major intrinsic membrane protein of erythrocytes, GYPA contributes significantly to membrane integrity. Its N-terminal glycosylated segment, projecting beyond the erythrocyte membrane, bears MN blood group receptors and plays a vital role in erythrocyte function. GYPA is particularly essential for the optimal activity of SLC4A1, and its presence is required for the high activity of this membrane transporter. Moreover, GYPA is implicated in the translocation of SLC4A1 to the plasma membrane. Beyond its structural role, GYPA acts as a receptor for influenza virus, Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175), and Hepatitis A virus (HAV), highlighting its diverse functional repertoire. Existing as a homodimer, GYPA is an integral part of the ankyrin-1 complex, collaborating with other proteins such as ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPB, and AQP1 in the erythrocyte membrane, thereby contributing to the overall structural integrity and functionality of these blood cells. The interaction with SLC4A1 results in the formation of a heterotetramer, emphasizing the cooperative nature of the erythrocyte membrane complex.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GYPA (S20-E91)
      Accession # A0A2K5WD82
    • 8*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    GYPA; Mi.V Glycoprotein (24 AA); Prev. MNS; Glycophorin Sta Type C; PAS-2; Glycophorin A, GPA; GPA; Glycophorin Erik; Sialoglycoprotein Alpha; Glycophorin MiI; MN Sialoglycoprotein; Glycophorin MiV; Glycophorin-A; Glycophorin SAT; CD235a; CD235a Antigen;

  • AA Sequence

    SSTTVPATHTSTSSLGPESYVSSQSNDKHTSDTHPTTPSAHEVSCSEFSGRTHYPPEEDNRERVQLVHEFSE

  • Predicted Molecular Mass

    9 kDa

  • Molecular Weight

    Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00