1. Recombinant Proteins
  2. Biotinylated Proteins
  3. GPA33 Protein, Human (Biotinylated, HEK293, His-Avi)

GPA33 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78136
Handling Instructions Technical Support

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The GPA33 protein is implicated in potentially playing a role in cell-cell recognition and signaling, suggesting its involvement in fundamental cellular processes related to intercellular communication. The precise mechanisms by which GPA33 operates in cell-cell recognition and signaling remain areas of interest, underscoring its potential significance in mediating molecular interactions that contribute to cellular responses. The versatile nature of GPA33 in these processes highlights its potential role in coordinating cellular recognition events and modulating signaling cascades, emphasizing the need for further exploration to elucidate its specific functions and molecular mechanisms.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q99795 (I22-V235)

Gene ID
Molecular Construction
N-term
GPA33 (I22-V235)
Accession # Q99795
8*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
Glycoprotein A33; GPA33; A33; MGC129986; MGC129987
AA Sequence

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV

Predicted Molecular Mass
26.5 kDa
분자량

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

GPA33 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GPA33 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GPA33 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78136
수량:
MCE Japan Authorized Agent: