GRE3 Protein, Saccharomyces cerevisiae (His)
The GRE3 protein is an aldose reductase that reduces the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, especially under stress conditions. MG is synthesized from dihydroxyacetone phosphate and is involved in cell cycle regulation and stress adaptation. GRE3 Protein, Saccharomyces cerevisiae (His) is the recombinant GRE3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GRE3 protein is an aldose reductase that reduces the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, especially under stress conditions. MG is synthesized from dihydroxyacetone phosphate and is involved in cell cycle regulation and stress adaptation. GRE3 Protein, Saccharomyces cerevisiae (His) is the recombinant GRE3 protein, expressed by E. coli , with N-6*His labeled tag.
Background
GRE3 Protein functions as an aldose reductase with a broad substrate specificity, exhibiting the capability to reduce the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, particularly under stress conditions. Methylglyoxal, synthesized through a bypath of glycolysis from dihydroxyacetone phosphate, is implicated in cell cycle regulation and stress adaptation. In pentose-fermenting yeasts, GRE3 catalyzes the reduction of xylose to xylitol. While the purified enzyme can perform this reaction, the inability of S. cerevisiae to thrive on xylose as a sole carbon source suggests that its physiological function is more likely oriented toward methylglyoxal reduction. This dual role in detoxifying cytotoxic compounds and participating in metabolic pathways underscores GRE3's versatility and importance in cellular stress response and adaptation.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
P38715 (M1-A327)
-
Gene ID856504
-
Molecular Construction
-
N-term
-
6*His
-
GRE3 (M1-A327)
Accession # P38715 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NADPH-dependent aldose reductase GRE3; EC:1.1.1.21; AR; ; NADPH-dependent aldo-keto reductase GRE3; Xylose reductase; EC:1.1.1.430; EC:1.1.1.431; GRE3; XYL1; XYLA; YHR104W
-
AA Sequence
MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKDISALNANIRFNDPWTWLDGKFPTFA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
