GRE3 Protein, Saccharomyces cerevisiae (His)

The GRE3 protein is an aldose reductase that reduces the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, especially under stress conditions. MG is synthesized from dihydroxyacetone phosphate and is involved in cell cycle regulation and stress adaptation. GRE3 Protein, Saccharomyces cerevisiae (His) is the recombinant GRE3 protein, expressed by E. coli , with N-6*His labeled tag.

GRE3 Protein functions as an aldose reductase with a broad substrate specificity, exhibiting the capability to reduce the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, particularly under stress conditions. Methylglyoxal, synthesized through a bypath of glycolysis from dihydroxyacetone phosphate, is implicated in cell cycle regulation and stress adaptation. In pentose-fermenting yeasts, GRE3 catalyzes the reduction of xylose to xylitol. While the purified enzyme can perform this reaction, the inability of S. cerevisiae to thrive on xylose as a sole carbon source suggests that its physiological function is more likely oriented toward methylglyoxal reduction. This dual role in detoxifying cytotoxic compounds and participating in metabolic pathways underscores GRE3's versatility and importance in cellular stress response and adaptation.

Others

E. coli

N-6*His

P38715 (M1-A327)

856504

Full Length

MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKDISALNANIRFNDPWTWLDGKFPTFA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.