1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GRE3 Protein, Saccharomyces cerevisiae

The GRE3 protein is an aldose reductase that reduces the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, especially under stress conditions. MG is synthesized from dihydroxyacetone phosphate and is involved in cell cycle regulation and stress adaptation. GRE3 Protein, Saccharomyces cerevisiae is the recombinant GRE3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GRE3 protein is an aldose reductase that reduces the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, especially under stress conditions. MG is synthesized from dihydroxyacetone phosphate and is involved in cell cycle regulation and stress adaptation. GRE3 Protein, Saccharomyces cerevisiae is the recombinant GRE3 protein, expressed by E. coli , with tag free.

Background

GRE3 Protein functions as an aldose reductase with a broad substrate specificity, exhibiting the capability to reduce the cytotoxic compound methylglyoxal (MG) to acetol and (R)-lactaldehyde, particularly under stress conditions. Methylglyoxal, synthesized through a bypath of glycolysis from dihydroxyacetone phosphate, is implicated in cell cycle regulation and stress adaptation. In pentose-fermenting yeasts, GRE3 catalyzes the reduction of xylose to xylitol. While the purified enzyme can perform this reaction, the inability of S. cerevisiae to thrive on xylose as a sole carbon source suggests that its physiological function is more likely oriented toward methylglyoxal reduction. This dual role in detoxifying cytotoxic compounds and participating in metabolic pathways underscores GRE3's versatility and importance in cellular stress response and adaptation.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

P38715 (M1-A327)

Gene ID

856504

Molecular Construction
N-term
GRE3 (M1-A327)
Accession # P38715
C-term
Protein Length

Full Length

Synonyms
GRE3; NADPH-dependent aldose reductase GRE3; AR; Genes de respuesta a estres protein 3; NADPH-dependent aldo-keto reductase GRE3; Xylose reductase
AA Sequence

MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKDISALNANIRFNDPWTWLDGKFPTFA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GRE3 Protein, Saccharomyces cerevisiae Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GRE3 Protein, Saccharomyces cerevisiae

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRE3 Protein, Saccharomyces cerevisiae
Cat. No.:
HY-P701871
Quantity:
MCE Japan Authorized Agent: