GSK-3 beta Protein, Human (Active, sf9)
GSK-3 beta is an active protein kinase that regulates a variety of cellular processes. It negatively regulates glucose homeostasis, Wnt signaling, and transcription factors by phosphorylating substrates such as glycogen synthase, CTNNB1, and JUN. GSK-3 beta, Human (Active, sf9) is the recombinant human-derived GSK-3 beta protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
GSK-3 beta is an active protein kinase that regulates a variety of cellular processes. It negatively regulates glucose homeostasis, Wnt signaling, and transcription factors by phosphorylating substrates such as glycogen synthase, CTNNB1, and JUN. GSK-3 beta, Human (Active, sf9) is the recombinant human-derived GSK-3 beta protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
GSK-3 beta, a constitutively active protein kinase, plays a multifaceted role in regulating diverse cellular processes. It serves as a negative regulator in hormonal control of glucose homeostasis, Wnt signaling, and transcription factors, exerting its effects by phosphorylating and inactivating key substrates such as glycogen synthase, EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU, and MACF1. In skeletal muscle, it contributes to insulin regulation of glycogen synthesis. GSK-3 beta's involvement in Wnt signaling leads to CTNNB1 degradation, while its phosphorylation of JUN and NFATC1/NFATC modulates their activity. The kinase also plays crucial roles in microtubule dynamics, influencing MAPT/TAU stability and contributing to ERBB2-dependent microtubule stabilization. Additionally, GSK-3 beta participates in diverse pathways such as NF-kappa-B regulation, pancreatic beta-cell replication, and apoptosis control through interactions with MCL1 and SNAI1. Furthermore, it orchestrates circadian rhythms, autophagy, and extrinsic apoptotic signaling, highlighting its central role in cellular homeostasis and response to external stimuli.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag Tag Free
-
Accession
P49841-1 (S2-T420)
-
Gene ID2932
-
Molecular Construction
-
N-term
-
(S2-T420)
Accession # P49841-1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GSK3B; Serine/Threonine-Protein Kinase GSK3B; Glycogen Synthase Kinase 3 Beta; GSK-3 Beta; Glycogen Synthase Kinase-3 Beta
-
AA Sequence
SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)