GSTP1 Protein, Human (His)
Based on 1 Customer Validation
The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (His) is the recombinant human-derived GSTP1 protein, expressed by E. coli , with N-10*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (His) is the recombinant human-derived GSTP1 protein, expressed by E. coli , with N-10*His labeled tag.
Background
The GSTP1 protein plays a crucial role in the cellular process of conjugating reduced glutathione to a diverse range of exogenous and endogenous hydrophobic electrophiles. Specifically, GSTP1 is actively involved in the formation of glutathione conjugates for prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as documented in studies. Furthermore, GSTP1 participates in the synthesis of novel hepoxilin regioisomers, underscoring its versatility in handling various substrates. Beyond its role in detoxification, GSTP1 negatively regulates CDK5 activity by facilitating the translocation of p25/p35, serving as a crucial mechanism to prevent neurodegeneration.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
P09211 (P2-Q210)
-
Molecular Construction
-
N-term
-
10*His
-
GSTP1 (P2-Q210)
Accession # P09211 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GSTP1; Epididymis Secretory Protein Li 22; Prev. FAEES3; Glutathione Transferase; Prev. GST3; Deafness, X-Linked 7; Glutathione S-Transferase P; Mutant GSTP1; GST Class-Pi; HEL-S-22; GSTP; DFN7; GSTP1-1; PI; Fatty Acid Ethyl Ester Synthase III; Glutathion
-
AA Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
