GYPA/CD235a Protein, Mouse (HEK293, His)
The GYPA/CD235a protein is an important component of the ankyrin 1 complex, which maintains the stability and shape of the red blood cell membrane. As a major intrinsic membrane protein, GYPA ensures the structural integrity and function of these blood cells. GYPA/CD235a Protein, Mouse (HEK293, His) is the recombinant mouse-derived GYPA/CD235a protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GYPA/CD235a protein is an important component of the ankyrin 1 complex, which maintains the stability and shape of the red blood cell membrane. As a major intrinsic membrane protein, GYPA ensures the structural integrity and function of these blood cells. GYPA/CD235a Protein, Mouse (HEK293, His) is the recombinant mouse-derived GYPA/CD235a protein, expressed by HEK293 , with C-His labeled tag.
Background
GYPA, a crucial component of the ankyrin-1 complex, intricately participates in maintaining the stability and shape of the erythrocyte membrane. Serving as the major intrinsic membrane protein of erythrocytes, GYPA plays a vital role in the structural integrity and functionality of these blood cells. The N-terminal glycosylated segment, projecting outside the erythrocyte membrane, hosts MN blood group receptors, underscoring its involvement in blood group determinants. Additionally, GYPA is integral for the proper function of SLC4A1, and its presence is essential for the high activity of SLC4A1. Furthermore, GYPA serves as a receptor for influenza virus, Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175), and Hepatitis A virus (HAV). Notably, it forms homodimers and is a key constituent of the ankyrin-1 complex, working in concert with other proteins such as ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPB, and AQP1 to maintain erythrocyte membrane architecture. The interaction with SLC4A1 results in the formation of a heterotetramer, highlighting the collaborative role of GYPA in the molecular organization of erythrocyte structures.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
P14220 (M1-V108)
-
Molecular Construction
-
N-term
-
GYPA (M1-V108)
Accession # P14220 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GYPA; Mi.V Glycoprotein (24 AA); Prev. MNS; Glycophorin Sta Type C; PAS-2; Glycophorin A, GPA; GPA; Glycophorin Erik; Sialoglycoprotein Alpha; Glycophorin MiI; MN Sialoglycoprotein; Glycophorin MiV; Glycophorin-A; Glycophorin SAT; CD235a; CD235a Antigen;
-
AA Sequence
MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 47-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
