HABP1/C1QBP Protein, Mouse (His)

The HABP1/C1QBP proteins are part of the MAM33 family, related to a unique family of proteins known for unique characteristics and functions. Among the MAM33 family, HABP1 may play an important role in related cellular processes, but its specific function still needs to be explored. HABP1/C1QBP Protein, Mouse (His) is the recombinant mouse-derived HABP1/C1QBP protein, expressed by E. coli , with N-His labeled tag.

HABP1/C1QBP protein is a member of the MAM33 family, categorizing it within a specific protein family known for its distinctive characteristics and functions. As part of the MAM33 family, HABP1 likely plays a significant role in cellular processes associated with this family, though specific functions require further exploration. Investigating the functions and implications of HABP1 within the broader context of the MAM33 family will contribute to a better understanding of its unique properties and potential roles in cellular processes, providing insights into its significance within this protein family.

Mouse

E. coli

N-His

Q8R5L1 (L72-Q279)

12261  [NCBI]

Partial

LHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ

Approximately 32 kDa.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.