HCC-4/CCL16 Protein, Human
Based on 1 Customer Validation
HCC-4/CCL16 Protein, Human is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
HCC-4/CCL16 Protein, Human is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by E. coli[1].
CCL16, also known as CC chemokine 4, liver expressed chemokine (LEC) and monotactin-1 (MTN-1), is a small cytokine belonging to the CC chemokine family, a cluster of chemokines located on human chromosome 17. CCL16 is also a ligand for the histamine H4 receptor. CCL16 can chemotacticize monocytes and lymphocytes but not neutrophils. Recent studies have shown that CCL16 increases tumor rejection, antigen presentation by macrophages, and angiogenic activity of vascular endothelial cells. On the other hand, CCL16 may also enhance the anticancer effects of cytotoxic T cells and dendritic cell (DC) lymphocytes[1][2].
CCL16 expression is upregulated in LPS-induced WI-38 cells, and CCL16 silencing inhibits LPS-induced apoptosis and inflammation in human lung fibroblast line WI-38 cells[2].
HCC-4/CCL16 (1-3000 ng/mL, 12 h) induces maximal chemotactic activity in CCR1-expressing HOS cells at a concentration of 1000ng/mL, transducing chemotactic signals via G i / Go proteins, PLC and PKCδ. It also activates the p38 MAPK signaling pathway in a time- and dose-dependent manner but with no effect on Ca2+ mobilization[3].
1. Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/mL.
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 1.25 μg/mL, corresponding to a specific activity is 800 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O15467 (Q24-Q120)
-
Molecular Construction
-
N-term
-
CCL16 (Q24-Q120)
Accession # O15467 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL16; Small-Inducible Cytokine A16; Prev. SCYA16; Liver-Expressed Chemokine; LCC-1; C-C Motif Chemokine 16; HCC-4; Chemokine LEC; NCC-4; Monotactin-1; LMC; ILINCK; Mtn-1; NCC4; CKb12; Liver CC Chemokine-1; SCYL4; C-C Motif Chemokine; LEC; New CC Chemokin
-
AA Sequence
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
-
Predicted Molecular Mass
11.2 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412. [Content Brief]
[2]. Strasly M, et al. CCL16 activates an angiogenic program in vascular endothelial cells. Blood. 2004 Jan 1;103(1):40-9. [Content Brief]
[3]. Jiahui Xu, et al. Silencing XIST mitigated lipopolysaccharide (LPS)-induced inflammatory injury in human lung fibroblast WI-38 cells through modulating miR-30b-5p/CCL16 axis and TLR4/NF-κB signaling pathway. Open Life Sci. 2021 Feb 6;16(1):108-127. [Content Brief]
[4]. In Sik Kim, et al. Differential CCR1-mediated chemotaxis signaling induced by human CC chemokine HCC-4/CCL16 in HOS cells. FEBS Lett. 2005 Nov 7;579(27):6044-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
