1. Recombinant Proteins
  2. Others
  3. HHLA2 Protein, Human (HEK293, Fc)

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, Fc) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, Fc) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The HHLA2 protein, a pivotal player in immune regulation, engages in a significant interaction with TMIGD2 to provide costimulation to T-cells during T-cell receptor (TCR)-mediated activation. This interaction, in turn, amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. The collaboration between HHLA2 and TMIGD2 underscores the intricate molecular mechanisms involved in enhancing T-cell responses, shedding light on its role in immune modulation.

Biological Activity

1.Measured by its binding ability in a functional ELISA.
2.Immobilized human TMIGD2 at 10 μg/mL (100 μL/well) can bind human HHLA2-Fc, the EC50 of human HHLA2-Fc is 0.3-3 μg/mL.
3.Loaded Recombinant Human KIR3DL3 Protein, His Tag on His1K Biosensor, can bind Recombinant Human B7-H7/HHLA2 Protein, hFc Tag with an affinity constant of 51.8 nM as determined in BLI assay (Sartorius Octet RED384)

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9UM44-1/NP_009003.1 (I23-N344)

Gene ID
Molecular Construction
N-term
HHLA2 (I23-N344)
Accession # Q9UM44-1/NP_009003.1
hFc
C-term
Protein Length

Partial

Synonyms
HERV-H LTR-associating protein 2; Human endogenous retrovirus-H long terminal repeat-associating protein 2
AA Sequence

IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHN

Molecular Weight

Approximately 63.7 kDa.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HHLA2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HHLA2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HHLA2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76970
Quantity:
MCE Japan Authorized Agent: