Copy Link Print Information

HHLA2 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, Fc) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • HHLA2 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, Fc) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The HHLA2 protein, a pivotal player in immune regulation, engages in a significant interaction with TMIGD2 to provide costimulation to T-cells during T-cell receptor (TCR)-mediated activation. This interaction, in turn, amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. The collaboration between HHLA2 and TMIGD2 underscores the intricate molecular mechanisms involved in enhancing T-cell responses, shedding light on its role in immune modulation.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA.
2.Immobilized human TMIGD2 at 10 μg/mL (100 μL/well) can bind human HHLA2-Fc, the EC50 of human HHLA2-Fc is 0.3-3 μg/mL.
3.Loaded Recombinant Human KIR3DL3 Protein, His Tag on His1K Biosensor, can bind Recombinant Human B7-H7/HHLA2 Protein, hFc Tag with an affinity constant of 51.8 nM as determined in BLI assay (Sartorius Octet RED384)

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q9UM44-1/NP_009003.1 (I23-N344)

  • Gene ID
    11148  [NCBI]
  • Molecular Construction
    • N-term
    • HHLA2 (I23-N344)
      Accession # Q9UM44-1/NP_009003.1
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HHLA2; B7y; HHLA2 Member Of B7 Family; Human Endogenous Retrovirus-H Long Terminal Repeat-Associating Protein 2; B7-H5; HERV-H LTR-Associating Protein 2; B7-H7; HERV-H LTR-Associating 2; B7H7

  • AA Sequence

    IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHN

  • Predicted Molecular Mass

    63.7 kDa

  • Molecular Weight

    Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HHLA2 Protein, Human (HEK293, Fc) Product Image
    1/16
  • HHLA2 Protein, Human (HEK293, Fc) Product Image