Histone H3 Protein, Xenopus laevis (98a.a, His)

Histone H3 Protein constitutes a core element in the nucleosome, an octamer comprising H2A, H2B, H3, and H4. The assembly forms a histone octamer with one H3-H4 heterotetramer and two H2A-H2B heterodimers, serving as a molecular spool that wraps around 147 base pairs of DNA. This compact organization contributes to chromatin structure, and Histone H3, as part of this assembly, plays a crucial role in chromatin structure and gene regulation. Histone H3 Protein, Xenopus laevis (98a.a, His) is the recombinant Xenopus laevis-derived Histone H3 protein, expressed by E. coli , with tag free.

The Histone H3 Protein is a fundamental component of the nucleosome, which comprises a histone octamer containing two molecules each of H2A, H2B, H3, and H4. This assembly consists of one H3-H4 heterotetramer and two H2A-H2B heterodimers, collectively forming the octameric core. Functioning as a molecular spool, the histone octamer wraps approximately 147 base pairs of DNA around itself, contributing to the compact organization of chromatin. Histone H3, as part of this assembly, belongs to the histone H3 family, playing a pivotal role in chromatin structure and gene regulation.

Xenopus laevis

E. coli

N-6*His

Q92133 (P39-A136)

399088  [NCBI]

Partial

PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Approximately 13 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.