p24 Protein, HIV-1 (BAH97658, His)
The capsid protein p24 forms the conical core of the genome RNA-nucleocapsid complex in the virion. Promote immune invasion by hiding the viral DNA detected by CGAS. The viral capsid protein p24 is considered to be another early virological biomarker of infection. p24 Protein, HIV-1 (BAH97658, His) is the recombinant Virus-derived p24 protein, expressed by E. coli , with C-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The capsid protein p24 forms the conical core of the genome RNA-nucleocapsid complex in the virion. Promote immune invasion by hiding the viral DNA detected by CGAS. The viral capsid protein p24 is considered to be another early virological biomarker of infection. p24 Protein, HIV-1 (BAH97658, His) is the recombinant Virus-derived p24 protein, expressed by E. coli , with C-His labeled tag.
Background
The Gag-Pol polyprotein assumes a central role in the virion assembly process, collaborating with the Gag polyprotein to orchestrate essential events such as binding to the plasma membrane, facilitating protein-protein interactions crucial for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA through direct interactions with the RNA packaging sequence (Psi). This polyprotein potentially regulates its own translation by binding genomic RNA in the 5'-UTR, exhibiting a dual role in promoting translation at low concentrations and encapsidating genomic RNA to inhibit translation at higher concentrations. The multipartite membrane-binding signal, including the myristoylated N-terminus, targets the polyprotein to the plasma membrane. Additionally, the Matrix protein within the polyprotein is implicated in the pre-integration complex and is associated with the release from the host cell mediated by Vpu. The ability of Gag-Pol to bind to RNA further underscores its multifaceted functions in the intricate process of virion assembly[1][2][3][4].
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag C-His
-
Accession
BAH97658 (P131-L362)
-
Gene ID/
-
Molecular Construction
-
N-term
-
p24 (P131-L362)
Accession # BAH97658 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Gag polyprotein; Pr55Gag; Matrix protein p17; MA; Capsid protein p24; CA; Spacer peptide 1; SP1; p2; Nucleocapsid protein p7; NC; Spacer peptide 2; SP2
-
AA Sequence
PVVANAQGQMVHQALSPRTLNAWVKAVEEKAFNPEIIPMFMALSEGAVPYDINTMLNAIGGHQGALQVLKEVINEEAAEWDRTHPPAMGPLPPGQLRDPTGSDIAGTTSTQQEQINWITRPNNPVPVGDIYRKWIVLGLNKMVKMYSPVSILDIKQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQNSNPDCKQILKALGPGATLEEMMVACQGVGGPTHKAKIL
-
Predicted Molecular Mass
26.6 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)