HMGB2/HMG-2 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. HMGB2/HMG-2 Protein, Human (HEK293, His) is the recombinant human-derived HMGB2/HMG-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. HMGB2/HMG-2 Protein, Human (HEK293, His) is the recombinant human-derived HMGB2/HMG-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HMGB2/HMG-2, a versatile protein with diverse cellular functions across various compartments, may act in a redox-sensitive manner. In the nucleus, it serves as an abundant chromatin-associated non-histone protein, playing crucial roles in transcription, chromatin remodeling, and V(D)J recombination, among other processes. HMGB2/HMG-2 exhibits a DNA-binding preference for non-canonical DNA structures, such as single-stranded DNA, and possesses the ability to bend DNA, enhancing flexibility through looping. This looping mechanism facilitates the promotion of activities on various gene promoters by augmenting transcription factor binding and bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination, HMGB2/HMG-2 acts as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the conserved recombination signal sequences. Additionally, it is proposed to participate in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor, cooperating with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment, HMGB2/HMG-2 acts as a chemokine, promoting proliferation and migration of endothelial cells and exhibiting antimicrobial activity in gastrointestinal epithelial tissues. It is implicated in inflammatory responses to antigenic stimuli and involved in the modulation of neurogenesis, likely by regulating neural stem proliferation. Furthermore, HMGB2/HMG-2 contributes to articular cartilage surface maintenance through interactions with LEF1 and the Wnt/beta-catenin pathway. It interacts with various proteins, including POU2F2, POU2F1, POU3F1, SET, and LEF1, highlighting its intricate role in diverse cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • HMGB2 (G2-E209)
      Accession # P26583
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    HMGB2; High Mobility Group Protein 2; Prev. HMG2; HMG-2; High Mobility Group Protein B2; High-Mobility Group Box 2; High Mobility Group Box 2; High-Mobility Group (Nonhistone Chromosomal) Protein 2

  • AA Sequence

    GKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

  • Predicted Molecular Mass

    25 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00