HPSE Protein, Rat (His-Myc)
Based on 1 Customer Validation
HPSE proteins cleave HSPG into heparan sulfate side chains and decorin, involved in ECM degradation and remodeling. HPSE promotes cell migration associated with metastasis, wound healing, and inflammation and acts as a procoagulant. HPSE also induces AKT1/PKB phosphorylation, enhancing angiogenesis, hair follicle differentiation and homeostasis. HPSE Protein, Rat (His-Myc) is the recombinant rat-derived HPSE protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HPSE proteins cleave HSPG into heparan sulfate side chains and decorin, involved in ECM degradation and remodeling. HPSE promotes cell migration associated with metastasis, wound healing, and inflammation and acts as a procoagulant. HPSE also induces AKT1/PKB phosphorylation, enhancing angiogenesis, hair follicle differentiation and homeostasis. HPSE Protein, Rat (His-Myc) is the recombinant rat-derived HPSE protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
Background
HPSE Protein functions as an endoglycosidase, playing a crucial role in the cleavage of heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. This enzymatic activity contributes to extracellular matrix (ECM) degradation and remodeling, selectively cleaving linkages within glucuronic acid units and N-sulfo glucosamine units carrying specific sulfation patterns. While predominantly inactive at neutral pH, HPSE becomes active under acidic conditions, such as during tumor invasion and inflammatory processes. This protein is implicated in various cellular processes, including facilitating cell migration associated with metastasis, wound healing, and inflammation. It enhances shedding of syndecans, promotes endothelial invasion and angiogenesis in myelomas, and acts as a procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Notably, HPSE also plays a role in cell adhesion to the ECM, independent of its enzymatic activity, and induces AKT1/PKB phosphorylation, thereby increasing cell mobility and invasion. Additionally, HPSE is involved in the regulation of osteogenesis, promotes angiogenesis through up-regulation of SRC-mediated activation of VEGF, and is implicated in hair follicle inner root sheath differentiation and hair homeostasis.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q71RP1 (K29-E102)
-
Molecular Construction
-
N-term
-
10*His
-
HPSE (K29-E102)
Accession # Q71RP1 -
C-term
-
-
Protein Length
Full Length of Heparanase 8 kDa subunit Chain
-
Synonyms
HPSE; Endo-Glucoronidase; Heparanase; HPA1; HPSE1; HPR1; HSE1; Hpa1; HPA; HEP; Heparanase-1
-
AA Sequence
KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE
-
Predicted Molecular Mass
15.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)