HRP-Labeled CD3 epsilon Protein, Human (HEK293, His)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. HRP-Labeled CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived HRP-Labeled CD3 epsilon protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. HRP-Labeled CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived HRP-Labeled CD3 epsilon protein, expressed by HEK293, with C-His labeled tag.

Background

CD3 epsilon, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, plays a crucial role in the adaptive immune response. As antigen-presenting cells (APCs) activate the T-cell receptor (TCR), CD3 epsilon, along with other CD3 chains (CD3D, CD3G, and CD3Z), facilitates the transmission of TCR-mediated signals across the cell membrane. Containing immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain, CD3 epsilon undergoes phosphorylation by Src family protein tyrosine kinases LCK and FYN upon TCR engagement, leading to the activation of downstream signaling pathways. Beyond its role in signal transduction, CD3 epsilon is essential for proper T-cell development, initiating the assembly of the TCR-CD3 complex by forming the heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3 epsilon is involved in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, which preferentially associate with TCRalpha and TCRbeta, forming trimers that interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta. CD3 epsilon's interactions with CD6, NCK1, and NUMB further highlight its pivotal role in orchestrating T-cell activation, development, and internalization processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD3 epsilon (D23-D126)
      Accession # P07766
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD3E; T3E; CD3 Epsilon Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3; T-Cell Surface Glycoprotein CD3 Epsilon Chain; CD3e Molecule; CD3-Epsilon; CD3e Antigen; CD3epsilon; CD3E Protein; CD3e Antigen, Epsilon Pol

  • AA Sequence

    DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

  • Predicted Molecular Mass

    12.6 kDa

  • Purity

    /

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

/

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00