HSD17B14 Protein, Human (HEK293, His)

HSD17B14 protein, with NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, converts oestradiol to oestrone. Its enzymatic activity extends to both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro, although the physiological substrate remains unidentified. HSD17B14 Protein, Human (HEK293, His) is the recombinant human-derived HSD17B14 protein, expressed by HEK293 , with C-His labeled tag.

The HSD17B14 protein exhibits NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity, facilitating the conversion of oestradiol to oestrone. While the physiological substrate remains unidentified, the protein demonstrates enzymatic activity on both oestradiol and 5-androstene-3-beta,17-beta-diol in vitro.

Measured by its ability to up-regulate expression of VIM gene by MCF-7 human breast cancer cell when Recombinant Human HSD17B14 at 1 μg/mL.

• 
  Measured by its ability to up-regulate expression of VIM gene by MCF-7 human breast cancer cell when Recombinant Human HSD17B14 at 1 μg/mL.

Human

HEK293

C-6*His

Q9BPX1/NP_057330.2 (M1-S270)

51171  [NCBI]

Full Length

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Approximately 29.8 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.