I-309/CCL1 Protein, Human (HEK293, mFc)
Based on 1 Customer Validation
I-309/CCL1 Protein, Human (HEK293, mFc) is the recombinant human-derived I-309/CCL1 protein, expressed by HEK293, with C-mFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
I-309/CCL1 Protein, Human (HEK293, mFc) is the recombinant human-derived I-309/CCL1 protein, expressed by HEK293, with C-mFc tag.
Background
I-309/CCL1 is a cytokine that exhibits chemotactic activity for monocytes but not for neutrophils. It functions by binding to the CCR8 receptor.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P22362 (K24-K96)
-
Gene ID6346
-
Molecular Construction
-
N-term
-
CCL1 (K24-K96)
Accession # P22362 -
mFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL1; SISe; Prev. SCYA1; Chemokine (C-C Motif) Ligand 1; T Lymphocyte-Secreted Protein I-309; Inflammatory Cytokine I-309; I-309; C-C Motif Chemokine 1; TCA3; Small-Inducible Cytokine A1; P500; C-C Motif Chemokine Ligand 1; Small Inducible Cytokine A1 (I-309, Homologous To Mouse Tca-3)
-
AA Sequence
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
-
Predicted Molecular Mass
35.4 kDa
-
Molecular Weight
Approximately 42-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)