IDUA Protein, Human (His)
Based on 1 Customer Validation
IDUA Protein, with catalytic activity, hydrolyzes unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. Its enzymatic function is crucial in breaking down these specific bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis. IDUA Protein, Human (His) is the recombinant human-derived IDUA protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IDUA Protein, with catalytic activity, hydrolyzes unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. Its enzymatic function is crucial in breaking down these specific bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis. IDUA Protein, Human (His) is the recombinant human-derived IDUA protein, expressed by E. coli , with N-6*His labeled tag.
Background
IDUA Protein exhibits catalytic activity, specifically engaging in the hydrolysis of unsulfated alpha-L-iduronosidic linkages within dermatan sulfate. Through its enzymatic function, IDUA plays a crucial role in breaking down these specific chemical bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P35475-1 (A28-P653)
-
Molecular Construction
-
N-term
-
6*His
-
IDUA (A28-P653)
Accession # P35475-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IDUA; Iduronidase, Alpha-L-; Alpha-L-Iduronidase; Iduronidase Alpha-L-; MPS1; IDUA Protein; MPSI; IDA; Mucopolysaccharidosis Type I
-
AA Sequence
APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
-
Predicted Molecular Mass
70.7 kDa
-
Molecular Weight
Approximately 71-74 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm solution of PBS, 6-8% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)