IFN alpha 1/IFNA1 Protein, Mouse (HEK293, His)
IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. IFN alpha 1/IFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN alpha 1/IFNA1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. IFN alpha 1/IFNA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN alpha 1/IFNA1 protein, expressed by HEK293, with C-His labeled tag.
Background
IFN alpha 1a Protein, synthesized by macrophages, possesses potent antiviral activities. Its primary role involves the stimulation of two pivotal enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response plays a crucial part in enhancing the host's immune defenses against viral threats.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P01572 (C24-K189)
-
Gene ID15962
-
Molecular Construction
-
N-term
-
IFNA (C24-K189)
Accession # P01572 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IFNA1; Interferon Alpha-1; Interferon Alpha 1; Interferon Alpha-D; IFN-AlphaD; Interferon-Alpha1; IFN-ALPHA; IFN-Alpha-1; IFNA13; LeIF D; IFNA@; Interferon Alpha-1/13; IFL; IFN-Alpha-1/13; IFN; IFN-Alpha 1b; Interferon Alpha 1b
-
AA Sequence
CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK
-
Predicted Molecular Mass
21 kDa
-
Molecular Weight
Approximately 24-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
