IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, hFc)

Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNAR1 at 2 μg/ml (100 μL/well) can bind Mouse IFNA2. The ED₅₀ for this effect is 73.44 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse IFNAR1 at 2 μg/mL (100 μL/well) can bind Mouse IFNA2. The ED₅₀ for this effect is 73.44 ng/mL.

Mouse

HEK293

N-hFc

P01573 (C24-E190)

15965

Full Length of Mature Protein

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Approximately 48-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.