IFN-alpha 6/IFNA6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 6/IFNA6 Protein, Human (HEK293, His) contains 169 a.a. (S21-E189), produced in HEK293 cells with a C-terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 6/IFNA6 Protein, Human (HEK293, His) contains 169 a.a. (S21-E189), produced in HEK293 cells with a C-terminal His-tag.

Background

IFN-alpha 6 (IFNA6; IFN-α6), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. IFN-alpha 6 involves in acute myocarditis and chronic cardiac inflammation inhibition, promotes systemic murine cytomegalovirus (MCMV) infection by reducing MCMV replication[4].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA6 protein of human is very different from mouse (56.61%)

In Vivo

Humanized IFN-alpha 6 (IFNA6) shows protection on systemic murine cytomegalovirus (MCMV) infection and myocarditis by DNA-inoculated manner, and reduces MCMV replication[4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFNA6 (S21-E189)
      Accession # P05013
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNA6; Interferon Alpha-K; Interferon Alpha 6; IFN-Alpha-6; IFN-AlphaK; LeIF K; Interferon Alpha-54; Interferon, Alpha 6; Interferon Alpha-6; Interferon 1AB1

  • AA Sequence

    SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

  • Predicted Molecular Mass

    21.1 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00