IFN-omega 1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IFN-omega protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Human (HEK293, His) is the recombinant human-derived IFN-omega protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IFN-omega protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Human (HEK293, His) is the recombinant human-derived IFN-omega protein, expressed by HEK293 , with C-His labeled tag.
Background
IFN-omega protein belongs to the alpha/beta interferon family.
Verified Bioactivity
Human IFNAR1, His Tag immobilized on CM5 Chip can bind Human Interferon omega-1, His Tag with an affinity constant of 20.96 μM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P05000 (L22-S195)
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNW1; Interferon Alpha-II-1; Interferon Omega 1; Interferon Omega-1; IFN-Omega 1, Interferon Omega-1; Interferon 1BA1
-
AA Sequence
LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 22-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
