IFN-omega 1 Protein, Human (HEK293, His)

IFN-omega protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Human (HEK293, His) is the recombinant human-derived IFN-omega protein, expressed by HEK293 , with C-His labeled tag.

IFN-omega protein belongs to the alpha/beta interferon family.

Human IFNAR1, His Tag immobilized on CM5 Chip can bind Human Interferon omega-1, His Tag with an affinity constant of 20.96 μM as determined in SPR assay (Biacore T200).

Human

HEK293

C-His

P05000 (L22-S195)

3467  [NCBI]

Full Length of Mature Protein

LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Approximately 21-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.