IGF2 Protein, Human (P.pastoris)

Customer Review

Based on 1 Customer Validation

The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. IGF2 Protein, Human (P.pastoris) is the recombinant human-derived IGF2 protein, expressed by P. pastoris , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. IGF2 Protein, Human (P.pastoris) is the recombinant human-derived IGF2 protein, expressed by P. pastoris , with tag free.

Background

The IGF2 protein, a member of the insulin-like growth factor family, plays a pivotal role in promoting growth and influencing fetoplacental development, particularly as a major fetal growth hormone in mammals. It is regulated by placental lactogen and contributes to tissue differentiation. In adults, IGF2 is involved in glucose metabolism in adipose tissue, skeletal muscle, and the liver. Acting as a ligand for integrin, it facilitates IGF2 signaling and positively regulates the function of the myogenic transcription factor MYOD1, controlling muscle terminal differentiation. Additionally, IGF2 inhibits myoblast differentiation and modulates metabolism by increasing mitochondrial respiration rates. Moreover, in glucose-mediated co-secretion with insulin, IGF2's counterpart, preptin, acts as a physiological amplifier of glucose-mediated insulin secretion. Notably, IGF2 exhibits osteogenic properties, enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3.

Verified Bioactivity

Immobilized Recombinant Human IGF-2 / IGF-II Protein at 5 μg/mL (100 μL/well) can bind Recombinant Human IGFBP4 Protein (His Tag), the EC50 is 40-180 ng/mL.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGF2 (A25-E91)
      Accession # P01344-1
    • C-term
  • Protein Length

    Full Length of IGF2

  • Synonyms

    IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734

  • AA Sequence

    AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Predicted Molecular Mass

    7.5 kDa

  • Molecular Weight

    Approximately 7.5 kDa, based on SDS-PAGE under reducing conditions

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of sterile 0.1% TFA, 8% Acetonitrile.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00