Copy Link Print Information

IGF2 Protein, Human

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

IGF2 Protein, Human is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • IGF2 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGF2 Protein, Human is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

Background

Insulin-like growth factor (IGF) modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Human Insulin-like Growth factor-2 (IGF-II) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts[1].

Verified Bioactivity

1.The ED50 is <20 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >5 × 104 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 1.5-6 ng/mL.

Results
  • Experimental Validation Results for IGF2 Protein, Human
    Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 3.658 ng/mL, corresponding to a specific activity is 2.733×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01344-1 (A25-E91)

  • Gene ID
    3481  [NCBI]
  • Molecular Construction
    • N-term
    • IGF2 (A25-E91)
      Accession # P01344-1
    • C-term
  • Protein Length

    Full Length of IGF2

  • Synonyms

    rHuIGF-2; Somatamedin A; IGF-II

  • AA Sequence

    AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Predicted Molecular Mass

    8.9 kDa

  • Molecular Weight

    Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IGF2 Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 4% sucrose, 4% mannitol, 0.02% Tween 80, pH 3.0.
2.Lyophilized from a 0.22 μm filtered solution of 25 mM Tris, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 3.658 ng/mL, corresponding to a specific activity is 2.733×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 3.658 ng/mL, corresponding to a specific activity is 2.733×105 units/mg.

  • 1/16

    IGF2 Protein, Human purchased from MedChemExpress. Usage Cited in: CNS Neurosci Ther. 2023 Nov;29(11):3430-3445. [Abstract]

    Customer Validation
     The levels of MCL1, BCL2L1, and HOXD-AS2 mRNA in GBM cells after treatment with IGF2 Protein and Human (1 μg/mL, 72 h) were quantitatively analyzed using RT-qPCR.

  • 1/16

    IGF2 Protein, Human purchased from MedChemExpress. Usage Cited in: CNS Neurosci Ther. 2023 Nov;29(11):3430-3445. [Abstract]

    Customer Validation
     The levels of IGF2 protein and STAT3 (phosphorylated Tyr705) protein after human treatment were detected by immunoblotting.

  • 1/16

    IGF2 Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(3):1097-1116. [Abstract]

    Customer Validation
     After treating PLC/PRF/5 cells and HepG2 cells with 0 ng/mL, 25 ng/mL, 50 ng/ml and 100 ng/mL IGF2 Protein, Human, respectively, for 24 hours, the protein level of BACH1 was measured.

  • 1/16

    IGF2 Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(3):1097-1116. [Abstract]

    Customer Validation
     PLC/PRF/5 cells were transfected with shETS1 or control shRNA in the presence of IGF2 Protein, Human (100 ng/mL, 24 h). BACH1 mRNA expression was detected by RT-qPCR.

  • 1/16

    IGF2 Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(3):1097-1116. [Abstract]

    Customer Validation
     Effects of ERK inhibitors on the levels of BACH1, p-ERK1/2, ERK1/2, p-ETS1, and ETS1 in PLC/PRF/5 cells treated with IGF2 Protein, Human (100 ng/mL, 24 h).

  • IGF2 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • Experimental Validation Results for IGF2 Protein, Human
  • IGF2 Protein, Human Product Image