IgG1 Protein, Human (Biotinylated, C103S, HEK293)
The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, C103S, HEK293) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (Biotinylated, C103S, HEK293) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with tag free.
Background
The constant region of immunoglobulin heavy chains, known as antibodies, represents membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, these membrane-bound immunoglobulins act as receptors, initiating the clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells upon binding specific antigens. Secreted immunoglobulins play a crucial role in the effector phase of humoral immunity, leading to the elimination of bound antigens. The antigen binding site is shaped by the variable domain of one heavy chain, along with that of its associated light chain, resulting in each immunoglobulin having two antigen binding sites with remarkable affinity for a particular antigen. Variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation for a specific antigen following exposure and selection. IgG1 protein mediates effector functions on monocytes, triggering antibody-dependent cellular cytotoxicity (ADCC) of virus-infected cells. Immunoglobulins are composed of two identical heavy chains and two identical light chains, interconnected by disulfide linkages, and interact with FCGR1A, FCGR2A, and FCGR3A to mediate various effector functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P01857-1 (E99-K330, C103S)
-
Molecular Construction
-
N-term
-
IgG1 (E99-K330)
Accession # P01857 -
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
IGHG1; Ig Gamma-1 Chain C Region NIE; Immunoglobulin Heavy Constant Gamma 1 (G1m Marker); Ig Gamma-1 Chain C Region KOL; Constant Region Of Heavy Chain Of IgG1; Ig Gamma-1 Chain C Region EU; Immunoglobulin Heavy Constant Gamma 1; Ig Gamma-1 Chain C Region
-
AA Sequence
EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
-
Predicted Molecular Mass
26.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)