IGSF11 Protein, Human (HEK293, His)

Immunoglobulin superfamily member 11 was originally identified as a member of the immunoglobulin superfamily, and it has been revealed to function as a CAM in a calciumindependent manner. Immunoglobulin superfamily member 11, a homophilic adhesion molecule that preferentially expressed in the brain, is a dual-binding partner of the postsynaptic scaffolding protein PSD-95 and AMPA glutamate receptors (AMPARs). IGSF11 Protein, Human (HEK293, His) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-His labeled tag.

Immunoglobulin superfamily member 11 is an immunoglobulin superfamily member that is preferentially expressed in brain and testis. Immunoglobulin superfamily member 11 shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule. Immunoglobulin superfamily member 11 enables ionotropic glutamate receptor binding and is involved in homophilic cell adhesion via plasma membrane adhesion molecules^[1][2][3][4].

Immobilized Human VISTA/B7-H5 (HY-P77879) at 2 μg/mL (100 μL/well) can bind Human IGSF11. The ED₅₀ for this effect is 0.2549 μg/mL.

• 
  Immobilized Human VISTA/B7-H5 (HY-P77879) at 2 μg/mL (100 μL/well) can bind Human IGSF11. The ED₅₀ for this effect is 0.2549 μg/mL.

Human

HEK293

C-His

AAH34411.1 (E23-G240)

152404  [NCBI]

Partial

EVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG

Approximately 36 kDa.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.