Copy Link Print Information

IGSF11 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Immunoglobulin superfamily member 11 was originally identified as a member of the immunoglobulin superfamily, and it has been revealed to function as a CAM in a calciumindependent manner. Immunoglobulin superfamily member 11, a homophilic adhesion molecule that preferentially expressed in the brain, is a dual-binding partner of the postsynaptic scaffolding protein PSD-95 and AMPA glutamate receptors (AMPARs). IGSF11 Protein, Human (HEK293, His) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IGSF11 Protein, Human (HEK293, His)
  • IGSF11 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Immunoglobulin superfamily member 11 was originally identified as a member of the immunoglobulin superfamily, and it has been revealed to function as a CAM in a calciumindependent manner. Immunoglobulin superfamily member 11, a homophilic adhesion molecule that preferentially expressed in the brain, is a dual-binding partner of the postsynaptic scaffolding protein PSD-95 and AMPA glutamate receptors (AMPARs). IGSF11 Protein, Human (HEK293, His) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-His labeled tag.

Background

Immunoglobulin superfamily member 11 is an immunoglobulin superfamily member that is preferentially expressed in brain and testis. Immunoglobulin superfamily member 11 shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule. Immunoglobulin superfamily member 11 enables ionotropic glutamate receptor binding and is involved in homophilic cell adhesion via plasma membrane adhesion molecules[1][2][3][4].

Verified Bioactivity

Immobilized Human VISTA/B7-H5 (HY-P77879) at 2 μg/mL (100 μL/well) can bind Human IGSF11. The ED50 for this effect is 0.2549 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human VISTA/B7-H5 (HY-P77879) at 2 μg/mL (100 μL/well) can bind Human IGSF11. The ED50 for this effect is 0.2549 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    AAH34411.1 (E23-G240)

  • Gene ID
    152404  [NCBI]
  • Molecular Construction
    • N-term
    • IGSF11 (E23-G240)
      Accession # AAH34411.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IGSF11; CXADRL1; Immunoglobulin Superfamily Member 11; BTIGSF; VSIG3; Brain And Testis-Specific Immunoglobin Superfamily Protein; BT-IgSF; V-Set And Immunoglobulin Domain Containing 3; Igsf13; Immunoglobulin Superfamily, Member 11; CT119; Alternative Prot

  • AA Sequence

    EVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG

  • Predicted Molecular Mass

    24.6 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Immobilized Human VISTA/B7-H5 (HY-P77879) at 2 μg/mL (100 μL/well) can bind Human IGSF11. The ED50 for this effect is 0.2549 μg/mL.

  • IGSF11 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IGSF11 Protein, Human (HEK293, His)
  • IGSF11 Protein, Human (HEK293, His) Product Image