IL-12R beta 1 Protein, Human (HEK293, hFc)
IL-12R beta 1 Protein, Human (HEK293, hFc) is the recombinant human-derived IL-12R beta 1 protein, expressed by HEK293, with C-hFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-12R beta 1 Protein, Human (HEK293, hFc) is the recombinant human-derived IL-12R beta 1 protein, expressed by HEK293, with C-hFc tag.
Background
IL-12R beta 1 functions as an interleukin receptor that binds interleukin-12 with low affinity and participates in IL12 signal transduction. It forms a functional high-affinity receptor for IL12 when associated with IL12RB2. Additionally, it combines with IL23R to form the interleukin-23 receptor, likely mediating IL23 signal transduction through activation of the Jak-Stat signaling cascade. by similar: Its interactions with other subunits modulate signaling pathways of different cytokines.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P42701-1 (C24-E540)
-
Gene ID3594
-
Molecular Construction
-
N-term
-
IL-12Rβ1 (C24-E540)
Accession # P42701-1 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IL12RB1; Interleukin-12 Receptor Beta-1 Chain; Prev. IL12RB; CD212 Antigen; CD212; IL-12R-Beta-1; Interleukin-12 Receptor Subunit Beta-1; IL-12R-BETA1; Interleukin 12 Receptor, Beta 1; IL-12RB1; IL-12 Receptor Beta Component; IMD30; IL-12 Receptor Subunit
-
AA Sequence
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
-
Predicted Molecular Mass
83.5 kDa
-
Molecular Weight
Approximately 95-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
