Copy Link Print Information

IL-13R alpha 2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-13R alpha 2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-13R alpha 2 Protein, Mouse (HEK293, His)
  • IL-13R alpha 2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-13R alpha 2 protein serves as a high-affinity receptor for interleukin 13 (IL-13) and functions as a decoy receptor, lacking the ability to induce signaling upon IL-13 binding. In mice lacking this protein, increased levels of serum immunoglobulins, immune-dependent interferon gamma production, and elevated bone marrow macrophage progenitor frequency are observed. Macrophages deficient in the encoded protein demonstrate reduced release of nitric oxide and IL-12 in response to lipopolysaccharide. Multiple transcript variants, encoding different isoforms, are generated through alternative splicing. The expression of IL-13R alpha 2 protein is biased in various tissues, including adult bladder and frontal lobe.

Verified Bioactivity

1.Measured by its ability to inhibit IL-13-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 0.017 μg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 5.88×104 units/mg.
2.Immobilized Mouse IL-13R2, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human IL-13, hFc Tag with the EC50 of 6.6 ng/mL determined by ELISA.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit IL-13-dependent proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.017 μg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 5.88×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    O88786-1/NP_032382.1 (L22-K334)

  • Gene ID
    16165  [NCBI]
  • Molecular Construction
    • N-term
    • IL-13Rα2 (L22-K334)
      Accession # O88786-1/NP_032382.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL13RA2; IL-13R Subunit Alpha-2; Interleukin 13 Receptor Subunit Alpha 2; IL-13R-Alpha-2; CD213a2; IL-13RA2; IL-13R; Interleukin-13 Receptor Alpha 2 Variant; IL13BP; Interleukin 13 Receptor Alpha 2 Chain; CT19; Interleukin 13 Binding Protein; Interleukin-

  • AA Sequence

    LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

  • Molecular Weight

    Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit IL-13-dependent proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.017 μg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 5.88×104 units/mg.

  • IL-13R alpha 2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-13R alpha 2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-13R alpha 2 Protein, Mouse (HEK293, His)
  • IL-13R alpha 2 Protein, Mouse (HEK293, His) Product Image