IL-17A Protein, Canine (HEK293, His)
IL-17A Protein, Canine (HEK293, His) is the recombinant canine-derived IL-17A protein, expressed by HEK293, with N-His tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-17A Protein, Canine (HEK293, His) is the recombinant canine-derived IL-17A protein, expressed by HEK293, with N-His tag.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag N-His
-
Accession
C6L8D7 (G26-A155)
-
Gene ID481837
-
Molecular Construction
-
N-term
-
His
-
IL-17A (G26-A155)
Accession # C6L8D7 -
C-term
-
-
Protein Length
Full Length of Interleukin-17A Chain
-
Synonyms
IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc
-
AA Sequence
GIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 15 kDa & 18-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
