IL-17B Protein, Human

Customer Review

Based on 1 Customer Validation

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells. Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis. IL-17B Protein, Human is the recombinant human-derived IL-17B protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells. Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis. IL-17B Protein, Human is the recombinant human-derived IL-17B protein, expressed by E. coli , with tag free.

Background

IL-17B protein plays a crucial role in cellular signaling by inducing the release of pro-inflammatory cytokines, specifically tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity highlights the protein's involvement in the regulation of immune responses and inflammatory processes, emphasizing its potential significance in mediating the crosstalk between immune cells and contributing to the overall immune homeostasis.

Verified Bioactivity

Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED50 for this effect is 1.169 μg/mL. Corresponding to a specific activity is 855.432 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED50 for this effect is 1.169 μg/mL. Corresponding to a specific activity is 855.432 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-17B (Q21-F180)
      Accession # Q9UHF5
    • C-term
  • Protein Length

    Full length of Mature Protein

  • Synonyms

    IL17B; MGC138901; Interleukin 17B; Neuronal Interleukin-17 Related Factor; IL-17B; Cytokine-Like Protein ZCYTO7; ZCYTO7; Interleukin-17 Beta; IL-20; Cytokine Zcyto7; NIRF; Interleukin 20; Neuronal Interleukin-17-Related Factor; Interleukin-20; Interleukin

  • AA Sequence

    QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

  • Predicted Molecular Mass

    18.2 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 3% trehalose, 0.1% Tween 20.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00