1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17B
  6. IL-17B Protein, Mouse (sf9, Fc)

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis. IL-17B Protein, Mouse (sf9, Fc) is a recombinant mouse IL-17B protein with hFc tag at the C-terminus and is expressed in Sf9 insect cells. It consists of 180 amino acids (M1-F180).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1][2]. IL-17B Protein, Mouse (sf9, Fc) is a recombinant mouse IL-17B protein with hFc tag at the C-terminus and is expressed in Sf9 insect cells. It consists of 180 amino acids (M1-F180).

Background

Interleukin-17B (IL-17B) belongs to the IL-17 cytokine family and is a proinflammatory cytokine. IL-17B is expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Murine IL-17B mRNA was detected in the whole mouse embryo[1][3].
The mouse IL-17B shares 88.33% amino acid sequence identity with human.
IL-17B is secreted as a non-covalent dimer glycoprotein. IL-17B shares about 27% amino acid identity with IL-17A and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β in the THP-1 monocytic cell line. The receptor of IL-17B is IL-17RB, which belongs to the IL-17 receptor family. IL-17B shares IL-17RB with IL-17E. IL-17B inhibits IL-17E binding to IL-17RA/IL-17RB complexes, exhibits protumor roles and IL-17E antitumor activities[1][2].
IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1].

In Vitro

mIL-17B (5 ng/mL; 24 h) induces IL-1β expression in 3T3 cells, and induces IL-1β, IL-6, and IL-23 expressions in PECs[4].

Biological Activity

Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED50 for this effect is typically 1.43 μg/mL.

  • Measured by its ability to induce IL-8 secretion by HepG2 cells. The ED50 for this effect is typically 1.43 μg/mL. Corresponding to a specific activity is 699.301 U/mg.
Species

Mouse

Source

Sf9 insect cells

Tag

C-hFc

Accession

Q9QXT6 (R23-F180)

Gene ID
Molecular Construction
N-term
IL-17B (R23-F18)
Accession # Q9QXT6
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-17B; IL-17B; Cytokine Zcyto7; IL-20; NIRF; ZCYTO7
AA Sequence

RNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

Predicted Molecular Mass
44.5 kDa
분자량

Approximately 57 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 100 mM Glycine, 10 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

IL-17B Protein, Mouse (sf9, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-17B Protein, Mouse (sf9, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-17B Protein, Mouse (sf9, Fc)
Cat. No.:
HY-P75835
수량:
MCE Japan Authorized Agent: