IL-17F Protein, Rat (sf9, N-His)

Customer Review

Based on 1 Customer Validation

Rat IL-17F is predicted to have cytokine binding and dimerization activities and is involved in bacterial defense, IL-17-mediated signaling, and regulation of cytokine production. It acts upstream of the inflammatory response, and its homologue to human IL17F has been implicated in chronic mucocutaneous candidiasis. IL-17F Protein, Rat (sf9, N-His) is the recombinant rat-derived IL-17F, Rat, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Rat IL-17F is predicted to have cytokine binding and dimerization activities and is involved in bacterial defense, IL-17-mediated signaling, and regulation of cytokine production. It acts upstream of the inflammatory response, and its homologue to human IL17F has been implicated in chronic mucocutaneous candidiasis. IL-17F Protein, Rat (sf9, N-His) is the recombinant rat-derived IL-17F, Rat, expressed by E. coli , with N-6*His labeled tag.

Background

IL-17F, Rat is predicted to possess cytokine binding activity, protein dimerization activity, and signaling receptor binding activity. The gene is anticipated to participate in various processes, including the defense response to bacterium, interleukin-17-mediated signaling pathways, and the regulation of cytokine production. It is predicted to act upstream of or within positive regulation of cytokine production involved in the inflammatory response and positive regulation of transcription by RNA polymerase II. The anticipated subcellular location is in the extracellular space. As the ortholog of human IL17F (interleukin 17F), IL-17F, Rat is implicated in chronic mucocutaneous candidiasis. Despite its functional significance, low expression levels have been observed in the reference dataset, suggesting that its regulatory functions may be tightly controlled or context-dependent.

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 45.19 ng/mL, corresponding to a specific activity is 2.212×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 45.19 ng/mL, corresponding to a specific activity is 2.212×104 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • IL-17F (A28-A161)
      Accession # NP_001015011.2
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17F; ML1; Interleukin 17F; Interleukin-17F; IL-17F; Cytokine ML-1; ML-1; CANDF6

  • AA Sequence

    ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA

  • Predicted Molecular Mass

    15.8 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCL, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00