IL-18R alpha Protein, Rat (HEK293, His)
Based on 1 Customer Validation
IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines[1]. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ[2]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3]. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.
Background
IL-18R alpha is expressed on CD4+ and CD8+ T cells but not expressed on naive T cells[4].
The amino acid sequence of human IL-18R alpha protein has low homology for mouse IL-18R alpha protein.
IL-18R alpha is the receptor of IL-18. IL-18 is extracellularly secreted and binds IL-18 receptor α (Rα) as well as IL-18 receptor β (Rβ) at the immunocyte plasma membrane in a stepwise manner. IL-18/IL-18Rα/IL-18Rβ ternary complex formation juxtaposes the intracellular Toll-Interleukin-1 receptor domains of IL-18Rα and IL-18Rβ. Then, the adaptor molecule myeloid differentiation factor 88 (MyD88) is recruited presumably with the aid of TRAM. MyD88 further interacts with IL-1 receptor associating kinase (IRAK) 4 and IRAK1/2 to form the large molecular assembly referred to as Myddosome, which subsequently activates IKK via TRAF6. Finally, the signal activates the NF-κB and mitogen-activated protein kinase pathways7, which upregulate the expression of various inflammatory cytokines[1].
IL-18R alpha binds to IL-18 and IL-18 receptor β forms a signalling complex induces the expression of various inflammatory cytokines[1]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
A0A8I6A1C2 (A18-G326)
-
Molecular Construction
-
N-term
-
IL-18Rα (A18-G326)
Accession # A0A8I6A1C2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL18R1; IL-18Ralpha; Interleukin 18 Receptor 1; CDw218a; IL-1Rrp; IL18Ralpha2 Splice Variant; IL1RRP; Cytokine Receptor; CD218 Antigen-Like Family Member A; CD218a Antigen; Interleukin-18 Receptor Alpha; IL18Ralpha2; IL1 Receptor-Related Protein; IL-18R-1
-
AA Sequence
APKSCIRRSQIHVVEGEPFYLKPCDMSAPMHNNETATMRWFKGNASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGNDRQNWTLNVTKRNKHSCFSEKLVTNRDVEVKKSLWITCENPSYGELINHTLLYKNCKEISKTPMILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNITVIEGNSKITPAIFGSKSAKVGVELGEDVELNCSAVLNRNDLFYWSIRKEDSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANEEATDTKSFILVRKETPDIQGHVFMRG
-
Molecular Weight
Approximately 54-64 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (266 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Tsutsumi N, et al. The structural basis for receptor recognition of human interleukin-18. Nat Commun. 2014 Dec 15;5:5340. [Content Brief]
[2]. Watanabe M, et al. Predominant expression of 950delCAG of IL-18R alpha chain cDNA is associated with reduced IFN-gamma production and high serum IgE levels in atopic Japanese children. J Allergy Clin Immunol. 2002 Apr;109(4):669-75. [Content Brief]
[3]. Takei S, et al. Soluble interleukin-18 receptor complex is a novel biomarker in rheumatoid arthritis. Arthritis Res Ther. 2011 Mar 24;13(2):R52. [Content Brief]
[4]. Smeltz RB, et al. Regulation of interleukin (IL)-18 receptor alpha chain expression on CD4(+) T cells during T helper (Th)1/Th2 differentiation. Critical downregulatory role of IL-4. J Exp Med. 2001 Jul 16;194(2):143-53. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
