IL-18R alpha Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines[1]. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ[2]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3]. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.

Background

IL-18R alpha is expressed on CD4+ and CD8+ T cells but not expressed on naive T cells[4].
The amino acid sequence of human IL-18R alpha protein has low homology for mouse IL-18R alpha protein.
IL-18R alpha is the receptor of IL-18. IL-18 is extracellularly secreted and binds IL-18 receptor α (Rα) as well as IL-18 receptor β (Rβ) at the immunocyte plasma membrane in a stepwise manner. IL-18/IL-18Rα/IL-18Rβ ternary complex formation juxtaposes the intracellular Toll-Interleukin-1 receptor domains of IL-18Rα and IL-18Rβ. Then, the adaptor molecule myeloid differentiation factor 88 (MyD88) is recruited presumably with the aid of TRAM. MyD88 further interacts with IL-1 receptor associating kinase (IRAK) 4 and IRAK1/2 to form the large molecular assembly referred to as Myddosome, which subsequently activates IKK via TRAF6. Finally, the signal activates the NF-κB and mitogen-activated protein kinase pathways7, which upregulate the expression of various inflammatory cytokines[1].
IL-18R alpha binds to IL-18 and IL-18 receptor β forms a signalling complex induces the expression of various inflammatory cytokines[1]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-18Rα (A18-G326)
      Accession # A0A8I6A1C2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL18R1; IL-18Ralpha; Interleukin 18 Receptor 1; CDw218a; IL-1Rrp; IL18Ralpha2 Splice Variant; IL1RRP; Cytokine Receptor; CD218 Antigen-Like Family Member A; CD218a Antigen; Interleukin-18 Receptor Alpha; IL18Ralpha2; IL1 Receptor-Related Protein; IL-18R-1

  • AA Sequence

    APKSCIRRSQIHVVEGEPFYLKPCDMSAPMHNNETATMRWFKGNASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGNDRQNWTLNVTKRNKHSCFSEKLVTNRDVEVKKSLWITCENPSYGELINHTLLYKNCKEISKTPMILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNITVIEGNSKITPAIFGSKSAKVGVELGEDVELNCSAVLNRNDLFYWSIRKEDSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANEEATDTKSFILVRKETPDIQGHVFMRG

  • Molecular Weight

    Approximately 54-64 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00