1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-38
  5. IL-1F10/IL-38 Protein, Human (P.pastoris, His)

IL-1F10/IL-38 protein is an immunomodulatory cytokine that indirectly regulates cytokine production. It reduces IL22 and IL17A production in T cells exposed to heat-killed Candida albicans and inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. IL-1F10/IL-38 Protein, Human (P.pastoris, His) is the recombinant human-derived IL-1F10/IL-38 protein, expressed by P. pastoris , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-1F10/IL-38 protein is an immunomodulatory cytokine that indirectly regulates cytokine production. It reduces IL22 and IL17A production in T cells exposed to heat-killed Candida albicans and inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. IL-1F10/IL-38 Protein, Human (P.pastoris, His) is the recombinant human-derived IL-1F10/IL-38 protein, expressed by P. pastoris , with C-His labeled tag.

Background

IL-1F10/IL-38 Protein is an immunomodulatory cytokine that does not directly induce cytokine production. Instead, it plays a regulatory role by reducing IL22 and IL17A production in T-cells following exposure to heat-killed Candida albicans. Additionally, it inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. Interestingly, IL-1F10/IL-38 Protein enhances IL6 production in dendritic cells stimulated by bacterial lipopolysaccharides (LPS). It acts as a ligand for IL-36R/IL1RL2 and interacts with the cargo receptor TMED10, facilitating translocation from the cytoplasm to the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) and subsequent secretion.

Biological Activity

Human IL-1 Rrp-2, hFc Tag captured on CM5 Chip via Protein A can bind Human IL-1F10, His Tag with an affinity constant of 35.38 μM as determined in SPR assay (Biacore T200).

Species

Human

Source

P. pastoris

Tag

C-8*His

Accession

Q8WWZ1 (M1-W152)

Gene ID
Molecular Construction
N-term
IL-38 (M1-W152)
Accession # Q8WWZ1
8*His
C-term
Protein Length

Full Length

Synonyms
Interleukin-1 Family Member 10; IL-1F10; IL-1HY2; IL-1 Theta; IL1F10; FIL1T; IL-38
AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Predicted Molecular Mass
18.1 kDa
분자량

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IL-1F10/IL-38 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-1F10/IL-38 Protein, Human (P.pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-1F10/IL-38 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P76427
수량:
MCE Japan Authorized Agent: