IL-1F10/IL-38 Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
IL-1F10/IL-38 protein is an immunomodulatory cytokine that indirectly regulates cytokine production. It reduces IL22 and IL17A production in T cells exposed to heat-killed Candida albicans and inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. IL-1F10/IL-38 Protein, Human (P.pastoris, His) is the recombinant human-derived IL-1F10/IL-38 protein, expressed by P. pastoris , with C-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-1F10/IL-38 protein is an immunomodulatory cytokine that indirectly regulates cytokine production. It reduces IL22 and IL17A production in T cells exposed to heat-killed Candida albicans and inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. IL-1F10/IL-38 Protein, Human (P.pastoris, His) is the recombinant human-derived IL-1F10/IL-38 protein, expressed by P. pastoris , with C-His labeled tag.
Background
IL-1F10/IL-38 Protein is an immunomodulatory cytokine that does not directly induce cytokine production. Instead, it plays a regulatory role by reducing IL22 and IL17A production in T-cells following exposure to heat-killed Candida albicans. Additionally, it inhibits IL36G-induced IL8 production in peripheral blood mononuclear cells. Interestingly, IL-1F10/IL-38 Protein enhances IL6 production in dendritic cells stimulated by bacterial lipopolysaccharides (LPS). It acts as a ligand for IL-36R/IL1RL2 and interacts with the cargo receptor TMED10, facilitating translocation from the cytoplasm to the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) and subsequent secretion.
Verified Bioactivity
Human IL-1 Rrp-2, hFc Tag captured on CM5 Chip via Protein A can bind Human IL-1F10, His Tag with an affinity constant of 35.38 μM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag C-8*His
-
Accession
Q8WWZ1 (M1-W152)
-
Molecular Construction
-
N-term
-
IL-38 (M1-W152)
Accession # Q8WWZ1 -
8*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
IL1F10; MGC119832; Interleukin 1 Family Member 10; MGC119833; IL-1HY2; MGC11983; IL1-Theta; IL1HY2; IL-1F10; Interleukin-1 Receptor Antagonist-Like FIL1 Theta; FKSG75; Interleukin 1 Family, Member 10 (Theta); IL-38; Interleukin 1 Family Member 10 (Theta);
-
AA Sequence
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
-
Predicted Molecular Mass
18.1 kDa
-
Molecular Weight
Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
