IL-22R alpha 1 Protein, Human (HEK293, His)

Interleukin 10 receptor beta (IL-10Rβ) is an important component of the interleukin 10 (IL-10), IL-22 and IL-24 receptor complex and plays a central role in mediating multiple signaling pathways effect. As part of the IL-10 receptor, IL-10Rβ forms a functional heterodimer with IL-10Rα and initiates IL-10 signaling through the JAK/STAT pathway. IL-22R alpha 1 Protein, Human (HEK293, His) is the recombinant human-derived IL-22R alpha 1 protein, expressed by HEK293, with C-His labeled tag.

IL-22R alpha 1, in conjunction with IL-10R beta, serves as a critical component of the receptor complexes for IL20, IL22, and IL24, orchestrating diverse signaling pathways. As part of the IL22 receptor, formed by the association of IL22RA1 and IL10RB, IL-22R alpha 1 enables IL22 signaling through the JAK/STAT pathways, concurrently triggering the activation of MAPK1/MAPK3 and Akt kinases. Additionally, IL-22R alpha 1, in collaboration with IL20RB, constitutes one of the receptors for IL20 and IL24, eliciting STATs activation. The receptor complex, particularly IL-22R alpha 1, plays a pivotal role in mediating IL24's antiangiogenic effects and its inhibitory impact on endothelial cell tube formation and differentiation. In its functional state, IL-22R alpha 1 forms heterodimers with IL10RB and IL20RB, with IL22 exhibiting a higher binding affinity to the heterodimer than to IL22RA1 alone. Furthermore, the interaction between IL-22R alpha 1 and FBXW12 promotes the ubiquitination of IL22RA1, adding a regulatory layer to its function.

Human

HEK293

C-8*His

Q8N6P7 (H16-T228)

58985

Extracellular Domain

HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.