IL-22R alpha 1 Protein, Human (HEK293, His)
Interleukin 10 receptor beta (IL-10Rβ) is an important component of the interleukin 10 (IL-10), IL-22 and IL-24 receptor complex and plays a central role in mediating multiple signaling pathways effect. As part of the IL-10 receptor, IL-10Rβ forms a functional heterodimer with IL-10Rα and initiates IL-10 signaling through the JAK/STAT pathway. IL-22R alpha 1 Protein, Human (HEK293, His) is the recombinant human-derived IL-22R alpha 1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Interleukin 10 receptor beta (IL-10Rβ) is an important component of the interleukin 10 (IL-10), IL-22 and IL-24 receptor complex and plays a central role in mediating multiple signaling pathways effect. As part of the IL-10 receptor, IL-10Rβ forms a functional heterodimer with IL-10Rα and initiates IL-10 signaling through the JAK/STAT pathway. IL-22R alpha 1 Protein, Human (HEK293, His) is the recombinant human-derived IL-22R alpha 1 protein, expressed by HEK293, with C-His labeled tag.
Background
IL-22R alpha 1, in conjunction with IL-10R beta, serves as a critical component of the receptor complexes for IL20, IL22, and IL24, orchestrating diverse signaling pathways. As part of the IL22 receptor, formed by the association of IL22RA1 and IL10RB, IL-22R alpha 1 enables IL22 signaling through the JAK/STAT pathways, concurrently triggering the activation of MAPK1/MAPK3 and Akt kinases. Additionally, IL-22R alpha 1, in collaboration with IL20RB, constitutes one of the receptors for IL20 and IL24, eliciting STATs activation. The receptor complex, particularly IL-22R alpha 1, plays a pivotal role in mediating IL24's antiangiogenic effects and its inhibitory impact on endothelial cell tube formation and differentiation. In its functional state, IL-22R alpha 1 forms heterodimers with IL10RB and IL20RB, with IL22 exhibiting a higher binding affinity to the heterodimer than to IL22RA1 alone. Furthermore, the interaction between IL-22R alpha 1 and FBXW12 promotes the ubiquitination of IL22RA1, adding a regulatory layer to its function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8N6P7 (H16-T228)
-
Gene ID58985
-
Molecular Construction
-
N-term
-
IL-22R alpha 1 (H16-T228)
Accession # Q8N6P7 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL22RA1; Interleukin 22 Receptor, Alpha 1; Prev. IL22R; IL-22R-Alpha-1; CRF2-9; IL-22RA1; Interleukin-22 Receptor Subunit Alpha-1; ZcytoR11; Cytokine Receptor Class-II Member 9; Interleukin 22 Receptor; Cytokine Receptor Family 2 Member 9; IL22R1; Interle
-
AA Sequence
HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT
-
Predicted Molecular Mass
25.7 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
